KEGG   Nostoc punctiforme: Npun_F4803Help
Entry
Npun_F4803        CDS       T00713                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
npu  Nostoc punctiforme
Pathway
npu00270  Cysteine and methionine metabolism
npu00480  Glutathione metabolism
npu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Npun_F4803
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Npun_F4803
Enzymes [BR:npu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     Npun_F4803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ACC83152
CyanoBase: Npun_F4803
CYORF: Npun_F4803
UniProt: B2IZ45
Position
5951331..5952314
Genome map
AA seq 327 aa AA seqDB search
MKLAFIIDPIHLLDPCHDTSIALIEAAQILGHEVWVTQANLLSVAEGKAWAVLQRVELVP
VQLVERRWIAANPWYKLSDSSLTSLETMDAVFMRTDPPVNDSYLYATYILDYVDQNKTLL
INSPSGIRGANEKMYALQFTKAIPETIVSADKQFIRQFVEAKGAAVLKPLGNKAGEGILF
LQSSDRNFNSIVELSTLQGRVPVMVQTYLPEAKEGDKRIILLNGEPIGALNRLSSGTDFR
NNMATGGTVAQTEITPREHEICTQVAERLRQDGLIFVGIDVIGGYLTEVNVTSPTGIREI
DRLDGTHLGYQVIQWIEQSLNSRRQEE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactggcttttatcattgatcccatccatctgcttgacccgtgtcatgataccagc
attgccctgatcgaagcagcgcaaatcctgggacacgaagtttgggtaactcaagcaaat
ctgctgagtgtggcggagggcaaagcttgggctgtcctacagcgagtcgaacttgtacca
gtgcagttggtggagagacgctggatagcggcgaatccttggtataagttaagtgattct
tccttaacttccttagagacaatggatgccgtatttatgcggacagatccacctgtcaat
gattcttacctctatgccacctacattttggattatgttgaccaaaataaaactctgctg
attaacagtcctagcggcattcgaggggcaaatgaaaaaatgtatgccctccagtttacc
aaagcgattccagaaacgattgtcagtgctgataagcagtttattcggcaatttgttgaa
gccaagggggcagctgttctcaaaccactgggaaacaaagccggggaaggaattttattt
ttgcaatcaagcgatcgcaattttaactccattgtcgaactcagtaccctccaaggtcga
gtgccagtaatggtacaaacctatctaccggaggcaaaagaaggagataaacgcattatc
ctgctcaatggcgaaccgattggtgcgctcaatcgcctctctagcggaactgattttcgc
aataatatggcaactggtggtacagtcgctcaaaccgaaattaccccaagagaacatgaa
atttgtacccaagtagccgaacgcttacgccaagatggtttaatttttgtgggtatagat
gttattggtggctacttaactgaagttaacgtcaccagtcctacgggaattcgtgaaatt
gatcgtctagatggtactcaccttggttatcaggttattcaatggattgaacagtcatta
aattcaaggaggcaggaagagtaa

DBGET integrated database retrieval system