KEGG   Nostoc punctiforme: Npun_F5183Help
Entry
Npun_F5183        CDS       T00713                                 

Definition
(GenBank) ATP-grasp domain protein
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
npu  Nostoc punctiforme
Pathway
npu00020  Citrate cycle (TCA cycle)
npu00640  Propanoate metabolism
npu00660  C5-Branched dibasic acid metabolism
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
npu01120  Microbial metabolism in diverse environments
npu01130  Biosynthesis of antibiotics
npu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Npun_F5183
   00640 Propanoate metabolism
    Npun_F5183
   00660 C5-Branched dibasic acid metabolism
    Npun_F5183
Enzymes [BR:npu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Npun_F5183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ACC83515
CyanoBase: Npun_F5183
CYORF: Npun_F5183
UniProt: B2J365
Position
6417861..6419087
Genome map
AA seq 408 aa AA seqDB search
MDLLEYQVKEWFGKIGIPVLPSQRIDHPTDLKRLKIRFPIVLKSQVHGAERAKAGGVRFA
ETTIDAIAAAQNIFSLPIWGELPEVVLAESQYDANQEFYLAVVLDTAVCRPVLLGCKEAD
IDWESAGEKMHHVVVEQEFSPFYARRLALKMGLQGTLMQSVSSVLEKMYHLFVQKDLDLV
EINPLAVSANGQVMALNGKVRINERAIKRHPDLAEMAAKIISRHTSTEINGILGDWDGVK
MHGKIGILGNGTGSVMATLDLVANAGGNPGVCLNLRHAFLTDTTPTTFRDRLETGLKILE
ADKGIQVILINFLGSIPQTEEVVKVIARVVQQDNSELESQVVRSNGSKSRQVQNFTPLVI
RLAGSEFNAARKYLATLKTHSDALLVVENLDEAVAAAVRLAKPTANKK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggatttattagagtatcaagttaaagaatggtttgggaagataggcattccggtcttg
ccctcccaacggattgaccatcctacagatttgaaacgtttaaaaattcgctttccgatt
gtactgaaatctcaagtacatggagcagagcgggcaaaagcgggtggagtcaggtttgcc
gaaacgacaattgatgcgatcgcagctgctcaaaatatttttagtctaccaatatggggc
gaattgccagaagtggtgctggcagaatcccaatacgacgcgaaccaagaattttattta
gcggtagtgttagatactgctgtctgccgaccagtacttttaggttgtaaagaagcagac
atcgattgggaatctgctggggaaaaaatgcatcatgttgttgtggaacaggaattttca
ccattttatgcccgaagactggctttgaaaatgggtttacaagggacgctgatgcagtcg
gtaagcagcgttttggagaagatgtaccatttatttgtgcaaaaagacctggatttagtc
gaaataaatcccttggcagttagtgctaatggtcaagttatggctctcaatggtaaagtc
aggatcaatgaacgggcaatcaagcgtcatccagacctagctgagatggcagcaaaaatt
atcagccgtcataccagtactgaaattaatggtattttaggtgactgggatggtgtgaaa
atgcacggtaaaatcggtattttaggtaatgggactggttcagtgatggcaactttggat
ttagtcgccaatgctggtggcaatccaggtgtttgtttaaatctacgtcatgctttcctc
acagatacgacaccaactaccttccgcgatcgcctagagacaggtctgaaaatcctggaa
gctgacaaaggcattcaagtaatactaataaacttcctgggtagcattcctcaaacagag
gaagtggttaaagttatagccagagttgtacagcaagacaacagcgaacttgaatcacaa
gttgtacgttctaatggtagtaaaagtcgtcaagtacagaattttacacccttagttatc
cgtcttgctggttctgaatttaatgctgctagaaaatatctagcaacactaaaaacccac
agcgatgcgctactcgtggtagaaaatttagatgaggcagtggcggcagcagttcgtctt
gctaaaccaactgctaataaaaagtag

DBGET integrated database retrieval system