KEGG   Nostoc punctiforme: Npun_F6223Help
Entry
Npun_F6223        CDS       T00713                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
npu  Nostoc punctiforme
Pathway
npu00130  Ubiquinone and other terpenoid-quinone biosynthesis
npu00627  Aminobenzoate degradation
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
npu01120  Microbial metabolism in diverse environments
npu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:npu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Npun_F6223
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Npun_F6223
Enzymes [BR:npu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     Npun_F6223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ACC84507
CyanoBase: Npun_F6223
CYORF: Npun_F6223
UniProt: B2IW46
Position
7701486..7702106
Genome map
AA seq 206 aa AA seqDB search
MSQKSKPLILGVSGASGLIYAVRAIKFLLEADYSIELVASKSTYMVWQSEQEIRMPPEPT
QQEQFWREQAGVALSGKLRCHPWGDVGAGIASGSFATLGMIIIPCSMSTVAKLAVGLSSD
LLERAADVQLKEGRKLVIVPRETPFSLIHLRNLTSLAEVGVRIVPAIPAWYHNPQTIEDL
VDFVVARALDQLDIDCIPIQRWEGRR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacagaaaagcaaacctctaattttaggcgtatcgggcgcatctggtctgatttac
gctgttcgcgcgatcaaatttttgctagaagcggattatagtattgaattggttgcctct
aaatctacttacatggtttggcagtcagaacaggaaattcggatgccaccagagccaact
caacaagaacaattttggcgagagcaagctggagttgcgctttcgggtaaactccgctgc
catccttggggtgacgttggagccgggattgcgagtggttcctttgccactctggggatg
ataattattccatgcagcatgagtacagtagcaaagctagcggttggcttgagttccgat
ttactagaacgggcagcagatgtccaacttaaagaagggcgaaagctggtcattgtgcct
cgtgaaacgccttttagcctcatccacctgcgtaacttaacctctttagctgaagttgga
gttagaattgttcccgcgattcccgcctggtaccataatccccaaaccatcgaggattta
gttgattttgtagttgcccgtgctttagatcaactagatattgactgcatcccaattcaa
aggtgggaaggtcgtcgctaa

DBGET integrated database retrieval system