KEGG   Nostoc punctiforme: Npun_F6313Help
Entry
Npun_F6313        CDS       T00713                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
npu  Nostoc punctiforme
Pathway
npu00860  Porphyrin and chlorophyll metabolism
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Npun_F6313
Enzymes [BR:npu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Npun_F6313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 AAA_16 Sigma54_activat AAA_29 AAA ABC_tran DUF815 AAA_18 tRNA_lig_kinase RNA_helicase AAA_30 EAP30 AAA_28 MMR_HSR1 AAA_27
Motif
Other DBs
NCBI-ProteinID: ACC84586
CyanoBase: Npun_F6313
CYORF: Npun_F6313
UniProt: B2IX51
Position
7791021..7792145
Genome map
AA seq 374 aa AA seqDB search
MSPTAQSTASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEISVVANDPFSSDPSDPDLMSDEVRQLLEQGAEIPVAHKKVQMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRADFDQNP
LVFLENYKPQQEALQEQIVNAQQLLPEVKLDYELRVKISEVCSELDVDGLRGDIVSNRAA
KALTAYEGRTEVTVDDICRVITLCLRHRLRKDPLESIDSGYKVAKVFSRVFGVELPESDT
AQKNGTGQKLGARS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgagtccaactgctcaatccacggcaagtgcgcgtcgcgtggtatttccttttacggca
attgtgggccaggaagaaatgaaactggcgctcctattgaacgtgattgaccccaagatt
ggtggtgtaatgatcatgggcgatcgcggtaccggtaaatccacaactatccgggcgctg
gcggatctgctgccagaaatttctgtggttgccaatgaccccttcagcagcgatcctagc
gaccccgacttgatgagtgatgaagtccgccaactcttagaacaaggggcggaaattcct
gtagctcataaaaaagtccaaatggtagacctgccgctaggagctacagaagaccgagtt
tgtggcacaatcgacattgagaaagctttatctgaaggtgtcaaagcctttgaaccggga
ctgctggcaaaggctaaccggggcattctctatgtagatgaagtcaacttactagatgac
cacctcgtagacgtgctactagattccgctgcgagtggatggaacactgtagaacgggaa
ggtatttctatccgtcacccagcacgttttgttcttgtgggttctggaaacccggaagaa
ggcgaactacgcccgcaactgctcgatcgctttgggatgcacgcagaaattcacaccgta
aaagaaccagccttgcgggtgcaaatcgtggaacaacgggcggattttgaccaaaatcct
ctagtatttctcgaaaattacaaaccccaacaagaggcattgcaagagcaaattgtcaat
gctcaacagcttttgccagaagtgaagcttgactatgaactgcgggtaaaaatttctgaa
gtctgttctgaattggatgtagatggtttgcggggtgacattgttagtaaccgggccgcg
aaagccttaacagcttatgaaggacgcactgaagttacagttgatgatatctgccgtgtg
attaccctatgcttgcgtcacagactccggaaagaccccttagaatcgattgattctggc
tacaaagtcgccaaagtttttagccgcgtctttggcgtagaattaccagaaagtgatact
gcacaaaaaaacggcacaggtcaaaagttaggggctagaagttaa

DBGET integrated database retrieval system