KEGG   Nostoc punctiforme: Npun_R0444Help
Entry
Npun_R0444        CDS       T00713                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
npu  Nostoc punctiforme
Pathway
npu00010  Glycolysis / Gluconeogenesis
npu00710  Carbon fixation in photosynthetic organisms
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
npu01120  Microbial metabolism in diverse environments
npu01130  Biosynthesis of antibiotics
npu01200  Carbon metabolism
npu01230  Biosynthesis of amino acids
Module
npu_M00002  Glycolysis, core module involving three-carbon compounds
npu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
npu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
npu_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Npun_R0444
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Npun_R0444
Enzymes [BR:npu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Npun_R0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ACC79223
CyanoBase: Npun_R0444
CYORF: Npun_R0444
UniProt: B2J715
Position
complement(543606..544619)
Genome map
AA seq 337 aa AA seqDB search
MIRVAINGFGRIGRNFARCWVGRENSQIDLVAINDTSDPRTNAHLLKYDSMLGKIKGAEI
SADDNSIIVNGKTIKCVSDRNPEKLPWRDWGIDLIIEATGVFTSKEGALKHVNAGAKKVL
ITAPGKNEDGTFVVGVNHHDYDHNIHNIISNASCTTNCLAPIAKVLNDKFGIIKGTMTTT
HSYTGDQRLLDASHRDLRRARAAAINIVPTSTGAAKAVALVIPDLKGKLNGVALRVPTPN
VSMVDFVVQVEKRTITEEVNQALKDAAEGPLKGILDYSELELVSSDYQGSDASSIVDSSL
TLVMGNDLVKVMAWYDNEWGYSQRVLDLAELVAEKWQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgattagagttgcaatcaacggtttcgggcggattggacgtaactttgcgcgttgctgg
gtgggtagagagaatagtcaaatcgatcttgtcgctattaatgacacatcagatcctaga
accaatgctcacctgctgaagtatgactcgatgctaggcaagatcaaaggtgctgagatt
agtgccgatgataactctatcatcgttaacggtaagaccattaagtgcgtatccgatcgc
aacccagaaaagttgccctggagagattggggaattgacctaattatcgaagcaacaggc
gtatttactagcaaagaaggagcgctaaagcatgtgaatgctggagccaagaaagttctg
attaccgctcctggtaaaaacgaggatggcacttttgtggttggtgtgaatcatcatgat
tatgaccacaacatacacaacattatcagtaacgctagctgtactaccaactgcttggca
ccaattgccaaggtattgaacgataagttcggcatcatcaaaggtacgatgaccaccacc
cacagctatacaggcgaccagcgtttgctagacgcttctcaccgggatttgcgacgggcg
agggccgcagcgataaacattgtacccacctccactggtgcagcgaaagcagtggcgctg
gttatcccagacctgaaaggcaagcttaatggcgttgccttgcgtgtaccaaccccgaac
gtctcaatggtagatttcgtagttcaggttgagaagcgtactattactgaagaagttaac
caagctctcaaagatgctgctgagggcccacttaaaggcattttggactatagcgaacta
gaattggtatcttccgattatcaaggtagtgatgcttcttcgattgtcgattccagcttg
actttggttatgggcaatgacttagtaaaagttatggcgtggtatgacaacgagtggggt
tacagccaacgagttttggatttggcagaattggtagctgagaagtggcaataa

DBGET integrated database retrieval system