KEGG   Nostoc punctiforme: Npun_R1079Help
Entry
Npun_R1079        CDS       T00713                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
npu  Nostoc punctiforme
Pathway
npu00310  Lysine degradation
npu01100  Metabolic pathways
npu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:npu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Npun_R1079
Enzymes [BR:npu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     Npun_R1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 Pyr_redox_3 NAD_binding_8 Mqo NAD_binding_9 Thi4 K_oxygenase Trp_halogenase FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACC79805
CyanoBase: Npun_R1079
CYORF: Npun_R1079
UniProt: B2IW60
Position
complement(1291542..1292756)
Genome map
AA seq 404 aa AA seqDB search
MYDFAIIGGGIVGLSTALALGKRYPNARILVLEKESQWAFHQTGNNSGVIHSGIYYKPGS
FKAKFCRDGSRSMVEFCQEHGIEHEVCGKVIVATEEQELPRLENLYQRGLDNGIEVKRIS
PEEVREIEPHVKCVGGLRVFSTGIVNYKQVCLKYAQLIQQQGGDLHLNTKVLKISPSGKN
QVLETNKGNFATRFVINCTGLHSDRTAKLGKVEPQAKIVPFRGEYYELTPEKRYLVKTLI
YPVPNPDFPFLGVHFTRMIDGSVHAGPNAVLSLKREGYKKTDFDLRDFLEVVTYPGFWKL
AAKHADEGIQEIIRSFSKAAFTRSLQKLIPEVQAEDLVPTHAGVRAQALMNDGKLVDDFL
IVSGQNSIHVCNAPSPAATSSLEIGKALVAEIPQPSHLDIAVTA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattttgcgattataggtgggggaatagttggactctctacagcattggcttta
ggaaaacgctatcccaatgcgcgtattttagtactagaaaaagagagtcaatgggcattt
caccaaaccggcaataatagcggggtaattcattctggtatttactacaaaccagggagt
ttcaaagctaaattttgtcgtgatggttctcgctctatggtagaattttgccaagagcat
ggaatagaacatgaagtttgtggtaaagtcattgttgcaacagaagaacaagaactacca
cgtctagaaaatctctaccaacgcggcttagacaatggtatagaagttaagagaatcagc
cccgaagaagtcagggaaattgaacctcacgtaaaatgcgtaggtgggcttcgggtattc
tcaactgggattgttaattacaagcaagtttgtttgaaatatgcccagctaattcaacaa
cagggcggagatttgcatctcaatacaaaagttctgaaaatctccccaagtggtaaaaat
caggtactagaaacaaacaaaggtaactttgcaacccgctttgtaattaattgtacggga
ttgcatagcgatcgcaccgccaaactaggtaaagttgaacctcaagccaaaatcgtccca
ttccggggagaatactacgaactcactccagaaaaacgctatctcgtcaaaacactaatt
tacccagttcccaatcccgattttcccttcctgggtgtccactttacccggatgattgat
ggtagcgttcacgcaggaccaaatgcggttctatccctcaaacgcgaaggttacaaaaaa
accgactttgacttacgagattttcttgaagtcgtcacctatcctggtttctggaaattg
gcagccaaacacgctgatgaaggcatccaagaaatcattcgttcctttagtaaagcagcc
ttcaccagaagtttgcaaaaactaattcccgaagtccaagcagaagacttagttcccacc
cacgcaggagttcgcgctcaagccttaatgaacgacggcaaacttgtagacgactttttg
attgtttccggtcaaaactccatccatgtttgcaatgctccttctccagcggccacatct
tctctagaaatcggcaaagcgcttgtagcagaaattccccaaccctcgcatctagatatt
gcagtaactgcatag

DBGET integrated database retrieval system