KEGG   Nostoc punctiforme: Npun_R1264Help
Entry
Npun_R1264        CDS       T00713                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
npu  Nostoc punctiforme
Pathway
npu00260  Glycine, serine and threonine metabolism
npu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
npu01130  Biosynthesis of antibiotics
npu01230  Biosynthesis of amino acids
Module
npu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Npun_R1264
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Npun_R1264
Enzymes [BR:npu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Npun_R1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB TMP-TENI NanE ThiG DHO_dh IGPS NMO Ribul_P_3_epim ALF RuvX
Motif
Other DBs
NCBI-ProteinID: ACC79985
CyanoBase: Npun_R1264
CYORF: Npun_R1264
UniProt: B2IXG3
Position
complement(1521314..1522141)
Genome map
AA seq 275 aa AA seqDB search
MTSISNSFQTLRDRQQCALIPFITAGDPNLETTAQALRILDRNGADFIELGIPYSDPLAD
GPVIQAAATRALQKGTKLEQVLEMLQAVTPTLKAPIILFTYYNPILHRGIKTFLAQIAAV
GVQGLVVPDLPLEEAEELIQTAASFGIEVILLVAPTSSKDRILAIARQSQGFIYLVSVTG
VTGIRAQIQDRVKDLITDLRSVTDKPIGVGFGISGPEQAHQVREWGADAVIVGSAFVKRL
AEGSPTERLQAVEKLCQELKAAITPVSLQQVVSAK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacctctatctccaattcctttcaaactttacgcgatcgccaacagtgtgctttaatc
ccctttattacagcaggcgatcctaacttagaaaccactgcccaagctttacgtatctta
gatcgcaacggcgctgacttcatcgagttgggtattccctactctgatcctctcgcagat
gggcctgttattcaagcagccgcaactcgcgctttgcaaaaaggcacgaaattagaacaa
gtattagagatgttgcaagctgtaactcctaccctgaaagcgccgataattctatttact
tactacaatcccattttgcaccggggtattaagacatttttggcgcaaattgctgctgtt
ggggtgcaagggttggtagtgccagacttgcccttagaagaagcagaagaattaatccaa
actgctgcatcttttgggattgaggtaattttactagtagctcctaccagttctaaagat
aggattttagcgatcgctcgtcaatctcagggttttatctacctggtaagcgtcacaggc
gttacaggtatccgcgctcaaatccaagaccgcgtaaaagatttaattaccgacttgcga
agcgtcaccgataaacccatcggcgttggttttggtatttccgggccagaacaagcgcat
caagtaagggaatggggagcagatgccgtgattgttggtagtgcctttgtcaaacggtta
gctgaaggcagcccaaccgaaagactacaagcagtagaaaagctttgccaagaactgaaa
gcagcaattaccccagtatccctgcaacaagttgtttccgcaaaataa

DBGET integrated database retrieval system