KEGG   Nostoc punctiforme: Npun_R4907Help
Entry
Npun_R4907        CDS       T00713                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
npu  Nostoc punctiforme
Pathway
npu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
npu01130  Biosynthesis of antibiotics
npu01230  Biosynthesis of amino acids
Module
npu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Npun_R4907
Enzymes [BR:npu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Npun_R4907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh
Motif
Other DBs
NCBI-ProteinID: ACC83253
CyanoBase: Npun_R4907
CYORF: Npun_R4907
UniProt: B2J0A1
Position
complement(6078307..6079158)
Genome map
AA seq 283 aa AA seqDB search
MTYPFTTPNTYLQPTLTEIIWQKKHEVAQIQQEMSLASLQRQLAAAPTVRDFISALQQSH
YRPCIIAEVKKASLIHGIIKADLDSVAIAKAYERGGATCISVFTDQKFFYGSFENLRTIR
YRVGLPLLCKEFILDPCQIYLARAAGADAVLLIAGILSDKELQNFLRVIHYLGMNALIEV
HTLAELDRVLKLDDVRLIGINNQSLEDFSVNIDTTEQLLAARRSQLQSLGIIVVSESGLY
TPADLSLVAEAGTHAVILGESLVKQEDIQQSVRNLLKPTAIFR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacttacccatttactacccctaatacttatttgcaacctactctgacagagattata
tggcagaaaaagcatgaagttgcacagattcagcaagagatgtctttggcttctttgcaa
cgccagttagctgctgcgccgactgtgcgagattttatctctgctttgcaacagagtcat
taccgaccttgtatcattgcagaggtgaaaaaagcatccctaattcatggaattattaaa
gcagatttggactcagtagcgatcgctaaagcctatgaacgtggtggcgcaacttgtatc
tctgtcttcaccgatcagaagttcttttatggcagctttgaaaatttacgcaccatccgc
taccgggtgggattgcctctactgtgcaaggaattcattttagatccctgccaaatttat
ttagcacgggcagcaggcgctgatgcggtgctattgattgcaggaattctctcagataag
gaacttcaaaactttttgcgagtgattcactatttgggaatgaatgctttgatagaagtc
catactttagcagaactagatcgggtgctaaagcttgatgatgtacgcctaataggaatt
aacaaccaaagtctagaagattttagcgtcaatattgacacaactgagcaactactggcg
gctaggcgatcgcaactacaaagcttgggcattatcgttgttagtgagtctggcttgtat
acacctgctgatttatcccttgtagctgaagctggtacacatgccgttatacttggcgaa
tccttagttaaacaagaagatatacaacagagtgtacgtaatctgctcaaacctacagct
attttcagataa

DBGET integrated database retrieval system