KEGG   Nostoc punctiforme: Npun_R4932Help
Entry
Npun_R4932        CDS       T00713                                 

Definition
(GenBank) light-independent protochlorophyllide reductase, B subunit
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
npu  Nostoc punctiforme
Pathway
npu00860  Porphyrin and chlorophyll metabolism
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:npu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Npun_R4932
Enzymes [BR:npu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Npun_R4932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red
Motif
Other DBs
NCBI-ProteinID: ACC83277
CyanoBase: Npun_R4932
CYORF: Npun_R4932
UniProt: B2J0C5
Position
complement(6110830..6112356)
Genome map
AA seq 508 aa AA seqDB search
MKLAYWMYAGPAHIGTLRIASSFKNVHAIMHAPIGDDYFNVMRSMLSRERDFTPVTTSVV
DRNVLARGSQEKVVDNIVRKDAEEHPDLIVLTPTCTSSILQEDLHNFVERAQLEAKGDVM
LADVNHYRYNELQAADRTLDQIVQYYIEKARKRGELAEGKTAKPSVNIIGTTTLGFHNNH
DCTELKRLMADLGIKVNTLIPEGASVNDLKKMSQAWFNLVPYRELGLTTARYLEEQFGTP
YIDITPMGVVETARCIRKIQQVINAQGAEVDYENFINEQTLHVSQAAWFSRSIDCQNLTG
KKAVVFGDNTHAAAITKILAREMGIHVVWAGTYCKYDAGWFREQVSEYCDEVLISEDHGE
IGDAIARVEPSAIFGTQMERHVGKRLDIPCGVIAAPIHVQNFPIGYKPFMGYEGTNQITD
LIYNSFTLGMEDHLLEIFGGHDTKEVITRGISADSDLNWTKDGQAELNKIPGFVRGKVKR
NTEKFARDRGFKEINAEVLYAAKEAVGA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggcttactggatgtatgcaggcccagcccacatcggcactctgcgaatcgct
agctcttttaaaaatgtccatgcgatcatgcacgctcccattggcgatgactactttaac
gtcatgcgctccatgctatcgcgggagagggatttcactccggtaacaaccagtgtcgtc
gatcgcaacgttttggcacgcggctcccaagagaaggtagtagataacatcgtccgcaag
gatgccgaggaacacccagatttgattgtgttaactcccacctgcacctccagcatcttg
caagaggatttgcacaactttgtcgaacgggcgcagttggaagcgaaaggagacgtaatg
ctggcggatgtaaaccactaccgctataacgaactgcaagccgccgatcgcactctcgat
caaattgtccaatactacattgaaaaagcccggaagcggggcgaattagctgagggcaaa
actgcaaagccctcggttaacatcatcggtactactaccctcggtttccacaacaatcac
gattgcaccgaactcaagcggctgatggctgatttgggaattaaggttaataccttgatt
cctgaaggtgcttcggtgaatgacttgaaaaagatgtcccaagcttggtttaacctggtg
ccttaccgtgaactcggtttgaccacagcgcgttacctggaagaacaattcggcacacct
tatatagacattactccaatgggtgtagtggaaactgcccgttgtattcgcaagattcag
caggtaattaacgctcaaggtgcagaagtcgactacgaaaacttcatcaatgaacaaacc
ctccatgtctctcaagctgcttggttctcccgttcaattgactgtcaaaacttgactggc
aaaaaagctgtggtctttggtgacaacacccacgccgccgccattactaagattctggcg
cgagaaatggggattcatgttgtttgggctggaacctactgcaaatatgatgcaggctgg
ttccgcgaacaggttagcgagtattgcgatgaagtgctaatttccgaagatcatggtgaa
attggggatgcgattgctcgtgtcgaaccctctgccattttcggcacccaaatggaacgc
cacgttggtaagcgtttggatattccctgcggcgtaattgctgcaccaatccacgtccaa
aacttccctattggttacaaaccatttatgggttacgaaggcacgaatcaaattacagat
ttaatctacaattccttcactttgggaatggaagatcacctgttagaaatcttcggtggt
cacgataccaaagaagttattactaggggaatttctgctgattctgatttgaattggaca
aaagatggtcaagcagaattgaataagattcctggatttgtgcgcggcaaagtgaagcga
aatactgagaaatttgcccgcgatcgcggtttcaaagaaatcaacgctgaggtgttgtac
gccgctaaggaagctgtgggggcgtag

DBGET integrated database retrieval system