KEGG   Nostoc punctiforme: Npun_R5095Help
Entry
Npun_R5095        CDS       T00713                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
npu  Nostoc punctiforme
Pathway
npu00561  Glycerolipid metabolism
npu00640  Propanoate metabolism
npu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Npun_R5095
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Npun_R5095
Enzymes [BR:npu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     Npun_R5095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase AIRC PrpR_N NAD_kinase PFK Amdase ANF_receptor
Motif
Other DBs
NCBI-ProteinID: ACC83429
CyanoBase: Npun_R5095
CYORF: Npun_R5095
UniProt: B2J243
Position
complement(6305984..6307174)
Genome map
AA seq 396 aa AA seqDB search
MSNQLSTQPSLSTQTSSSLFTLTVAPAKVIRGSGVLQAAAAEIACLGSRPLIVAGESTLA
ISRKNLQPVLETQQLHPVQASYGADCCEASLKSLQKKAKEHKADVIIGVGGGKALDTAKL
LAQQLQLPVVTIPTSGATCAAWSALSNVYSENGAFLYDVGLSRCPDLLILDYDLIQTAPQ
RTLVAGIGDAIAKWYEASVSSGHLQDTLIIAAVQQARVLRDILLQKSAAALKEPGSEVWR
EVVDASVLLAGVVGGLGGAQCRTVAAHAVHNGLTHISGHGSIHGEKVAFGILVQLRLEEM
LQGNQLAASARQQLLKFYTEIGLPQKLSDLGLGNITLGELQTAAEIALVPNSDIHRLPFK
VAPEQLMAAMVSTTAPIDSKDMNRVSPKGISDEVEE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcaactttctactcaaccttctttgtctactcaaacctctagctcattattt
acgctcacagttgccccggcaaaagtcatccgtggttctggggtattgcaagcagccgca
gcagagatcgcctgtttgggaagtcgtcccttaattgtggcaggtgaatcgactctcgct
atcagccgaaagaatttgcaaccagttttagaaacgcaacagttacatcctgttcaagct
tcttatggtgcagattgctgcgaagctagcctgaaatctttacagaagaaggcaaaagaa
cataaagctgatgtgattattggtgttggtggcggcaaagccttagatacagcaaaatta
ctcgcgcagcagttacagttgccagtggtgacaattccgacatcaggggctacctgtgca
gcttggagtgccttgtcgaatgtttattcggaaaatggggcatttctctacgatgtgggg
ctgtctcgttgtcccgatttactgatactcgattatgacttgattcaaactgcaccacaa
cggactttagtagctggaattggtgatgcgatcgctaagtggtatgaagcctctgttagc
agtgggcatttgcaagacactttaattattgctgcggtgcaacaagcaagagttttgcga
gatatcctcttgcaaaagtcagccgccgccttgaaggaaccaggtagcgaagtttggcga
gaagtcgtagacgcaagtgttttattagctggggtagttggaggacttggaggggcccag
tgtcgcacagttgctgcccatgccgtgcataatggtttaactcatatttcaggacatggc
agtattcatggcgaaaaggttgcttttggaattttggtgcaactgcgtttagaagaaatg
ctacaaggcaatcaactagcagcatcagcacgacaacagttgttaaagttctacacagaa
attggactaccccaaaaattaagtgatttgggattgggcaatattacattaggtgagtta
caaacagccgccgaaattgctctagttcctaattctgacatccatcgactaccgtttaaa
gtcgcgccagaacagttgatggcagcaatggtttccaccactgcacctatagatagtaaa
gacatgaatcgagtttcgcccaagggaatcagtgacgaggttgaagaatga

DBGET integrated database retrieval system