KEGG   Nostoc punctiforme: Npun_R5161Help
Entry
Npun_R5161        CDS       T00713                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
npu  Nostoc punctiforme
Pathway
npu00520  Amino sugar and nucleotide sugar metabolism
npu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Npun_R5161
Enzymes [BR:npu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Npun_R5161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind KR adh_short
Motif
Other DBs
NCBI-ProteinID: ACC83493
CyanoBase: Npun_R5161
CYORF: Npun_R5161
UniProt: B2J2A7
Position
complement(6391563..6392513)
Genome map
AA seq 316 aa AA seqDB search
MRILVTGGAGFIGSHLIDRLMTEGHELICLDNFYTGHKRNILKWLGHPYFELIRHDITEP
IRLEVDQIYHLACPASPVHYQYNPVKTVKTNVMGTLNMLGLAKRVKARFFLASTSEVYGD
PEVHPQTEEYRGSVNPIGIRSCYDEGKRIAETLAFDYYRQNKVDIRVVRIFNTYGPRMLE
NDGRVVSNFIVQALRGNPLTVYGDGSQTRSFCYVSDLVEGFIRLMNGDYVGPVNLGNPGE
YTILQLAQAVQNMIDPDAQIKFEPLPSDDPRRRQPDITKAKTLLNWEPTIPLQEGLKLTI
EDFRDRIQGDVNNSTN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagaattttggtgacgggcggtgctgggtttattggttcccatctcatcgaccgatta
atgaccgaggggcatgaattaatatgcttggataacttttacactggccataaacgtaac
attcttaaatggttaggtcatccgtattttgaactgatccgtcacgatattaccgaacca
attcggttagaagtggatcaaatttatcatttagcttgccctgcttcaccagtacattac
cagtacaacccagttaaaaccgttaagactaacgttatgggaaccctgaatatgttgggg
ctggctaaacgtgtgaaagctaggtttttcttggcttcaactagcgaagtatacggagat
ccagaagttcatccccaaactgaagagtataggggtagcgtcaatcccattgggatacgt
tcatgctacgacgaaggtaaaagaattgctgagactttagcatttgattactacagacaa
aataaagttgatattcgagttgtgcgaatatttaatacctacggcccgagaatgttagaa
aacgatggtcgggtagtaagcaattttatagttcaagccttgcgaggtaatcctttaact
gtttatggcgatggttcgcaaactcggagtttttgctatgtttccgatttggtagaagga
ttcatccgcctgatgaatggcgactatgttggcccagtaaatttgggtaatcctggagaa
tacacgattttacaattggcacaagctgtgcagaacatgatcgatccagacgcacagatt
aaatttgagccactaccttcggacgatccgcgtcgtcgccagcctgatattactaaggca
aagactttgttaaattgggaacctaccattcctctgcaagaagggttaaaactgacaata
gaagatttccgcgatcgcattcaaggcgatgtcaataattcaaccaactaa

DBGET integrated database retrieval system