KEGG   Novosphingobium resinovorum: BES08_06425Help
Entry
BES08_06425       CDS       T04490                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nre  Novosphingobium resinovorum
Pathway
nre00010  Glycolysis / Gluconeogenesis
nre00053  Ascorbate and aldarate metabolism
nre00071  Fatty acid degradation
nre00280  Valine, leucine and isoleucine degradation
nre00310  Lysine degradation
nre00330  Arginine and proline metabolism
nre00340  Histidine metabolism
nre00380  Tryptophan metabolism
nre00410  beta-Alanine metabolism
nre00561  Glycerolipid metabolism
nre00620  Pyruvate metabolism
nre00625  Chloroalkane and chloroalkene degradation
nre00903  Limonene and pinene degradation
nre01100  Metabolic pathways
nre01110  Biosynthesis of secondary metabolites
nre01120  Microbial metabolism in diverse environments
nre01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BES08_06425
   00053 Ascorbate and aldarate metabolism
    BES08_06425
   00620 Pyruvate metabolism
    BES08_06425
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BES08_06425
   00561 Glycerolipid metabolism
    BES08_06425
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BES08_06425
   00310 Lysine degradation
    BES08_06425
   00330 Arginine and proline metabolism
    BES08_06425
   00340 Histidine metabolism
    BES08_06425
   00380 Tryptophan metabolism
    BES08_06425
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BES08_06425
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BES08_06425
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BES08_06425
Enzymes [BR:nre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BES08_06425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Rep_trans
Motif
Other DBs
NCBI-ProteinID: AOR76427
UniProt: A0A1D8A2U1
Position
complement(1393251..1394753)
Genome map
AA seq 500 aa AA seqDB search
MHIATKERAMSSFDPDTIGIEVQNNFIGGRRALGQGTPMEVRRPSDARVYAALDSASAGQ
VEAAVEDAARAYRTSGWAATDPRARMKVMRRWADLIETDMALLAPLEALGSTRTIAEVLA
WDVSYTAETLRFFAEFADKAGGEVIATTPDKLGMTITEPYGVVAAIAPWNLPLVMAAWKI
APAIAAGNSVVLKPSEMTPFSIVRIAELAIEAGLPAGVFNVVQGDGLSVGDPLCRHPLVS
KVSFTGSTRTGIAIMEACAQTGPKPVTLELGGKSPQIVFADANDIAATAATVARAITLNS
GQVCVAGSRLLVQDKVANEVVDRIKAAVEAHTQGQTWSAATTIGPIISEKQLGQIDGIVS
RAIAAGGEALTGGSRAAAPQEGSYYAPTILTGLGQDAEAVRGEIFGPVLTVQTFADEEEA
YALANDSPYGLAAGVHTGDLNRALRATRALEAGTVWVNRYGRSNDFMLPTGGFKQSGIGK
DLGREAYMASLKTKAALIQL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcacatagcaacgaaggagcgcgcgatgagcagctttgatcctgacacgatcggcata
gaggtccagaacaacttcatcggcggccgccgcgcgctgggtcagggcacgccgatggaa
gtgcgccgcccctccgacgcgcgcgtctatgccgcgctcgacagtgcttcggccgggcag
gtcgaggcggcggtagaagatgctgcgcgtgcctacaggaccagcggctgggccgccacc
gacccgcgtgcgcgcatgaaagtgatgcgccgctgggccgatctcatcgagacggacatg
gcgctgctggccccgctcgaagcgctgggatcgacccgtaccatcgccgaagtgctggcc
tgggacgtgagctataccgcagaaaccctgcgcttcttcgccgaattcgcggacaaggcc
gggggcgaggtgatcgccaccacgcccgacaagcttggcatgacgatcactgagccttac
ggcgtcgtggccgctatcgcgccgtggaacctgccgctggtgatggcggcgtggaagatc
gccccggccatcgcggcgggcaattcggtggtgctcaagccgtcggaaatgacgcccttc
agcatcgtgcgcatcgccgaactcgccattgaggcgggacttccggcgggcgtgttcaac
gtggtgcagggcgatgggctgagcgtcggcgatccgctgtgccgtcatccgctggtgtcc
aaggtcagcttcaccggatcgacccgcactggcatcgcgatcatggaagcctgcgcgcag
accggtcccaagccggtgacgctggaactgggcggcaagagcccgcagatcgtcttcgcc
gatgccaacgacatcgccgccaccgccgccaccgtggcgcgcgcgatcacgctcaacagc
gggcaggtctgcgtcgcgggatcgcgtctgctggtgcaggacaaggtcgcgaacgaggtg
gtcgaccggatcaaagccgccgtcgaggcgcacacgcagggccagacctggagcgcggcg
acgacgatcgggccgatcatttcggaaaagcagctaggccagatcgacggcatcgtctcg
cgcgcgatcgcggccgggggcgaggccctgaccggcggcagccgcgccgccgcgccgcag
gagggcagctactatgcgcctaccatcctgaccggactgggtcaggacgccgaagcggtg
cgcggcgaaatcttcggcccggttctgaccgtccagaccttcgccgacgaggaagaggct
tatgcgctggccaacgacagcccgtacggccttgccgccggcgtccacaccggcgacctc
aatcgcgccctgcgcgctacgcgggcgctggaggcgggcaccgtctgggtgaaccgctac
ggccgcagcaacgacttcatgctgccgaccggcggcttcaagcagtccggcatcggcaag
gatctggggcgcgaggcctacatggcgagcctgaagaccaaggcggcgctgatccagttg
tga

DBGET integrated database retrieval system