KEGG   Novosphingobium resinovorum: BES08_08525Help
Entry
BES08_08525       CDS       T04490                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
nre  Novosphingobium resinovorum
Brite
KEGG Orthology (KO) [BR:nre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:nre03009]
    BES08_08525
Enzymes [BR:nre01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BES08_08525
Ribosome biogenesis [BR:nre03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BES08_08525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AOR76787
UniProt: A0A1D8A3W4
Position
1836594..1837535
Genome map
AA seq 313 aa AA seqDB search
MGALTNIIEGEVASGGRIDKALAEVSGLSRERIKALMGEGRVSLAGKPVAQASLKVDAGT
PFAIDVPEATPAEAVPQDIPLVVVYEDEHLIIVDKPAGLVVHPAAGNLDGTLVNALLHHC
RGQLSGIGGVARPGIVHRIDKDTSGLLVVAKTDKAHEGLAVQFADHSIERAYHAVVGGRP
VPVAGTVRGAIARSSHDRKKMALVEDGRGKHAITHFRTLEALRGATLVECRLETGRTHQV
RVHMASIGHALLGDPVYGRTPSPLRPILSRLGFSRQALHAAELGFVHPVSQERVHFASSL
PDDMRTLIDELRH
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgcttacaaacatcatcgaaggcgaagtcgccagtggcggccggatcgacaag
gccctggccgaagtcagcggcctgtcgcgcgaacgcatcaaggcgctgatgggtgaaggc
cgcgtctcgctcgccggaaagcccgtggcacaggcctcgctgaaagtggatgccggaaca
ccgtttgccatcgacgtgcccgaggctacgcccgcagaggcggtgccgcaggacattccc
cttgtcgtggtttacgaggacgaacacctgatcatcgtggacaagcccgccggactcgtc
gtccacccggccgcgggcaatctcgacggaacgctggtgaacgccctgctccaccactgc
cggggccagttgtccggcatcggcggcgtagcgcgccccggtatcgtccaccgcatcgac
aaggacacttcggggctgctcgtcgtcgccaagaccgacaaggcgcacgaagggctggcc
gtgcagttcgccgatcactcgatcgaacgcgcctatcacgccgtcgtcggcggcaggccg
gtgccggtagccggaaccgtgcgcggcgcgatcgcccgctcgtcgcatgatcgcaagaag
atggcgctggtggaggacgggcgcggcaagcacgcgatcacgcatttccgcacgctggag
gcgctgcgcggcgccactctcgtcgaatgcaggctggaaacgggacgaacgcatcaggtc
cgtgttcacatggcgtcaatcggtcatgcgctattgggagaccctgtctatgggcgaact
ccttctccgcttcgaccgattctctcccgactcggtttttcccgccaagcgctccacgct
gcggaactcgggttcgttcaccccgtttcacaagaaagggtccatttcgccagctcgctg
cccgacgacatgcggacactgatcgacgaactgcgacactga

DBGET integrated database retrieval system