KEGG   Novosphingobium resinovorum: BES08_09250Help
Entry
BES08_09250       CDS       T04490                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
nre  Novosphingobium resinovorum
Pathway
nre03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nre00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BES08_09250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nre03011]
    BES08_09250
Ribosome [BR:nre03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BES08_09250
  Bacteria
    BES08_09250
  Archaea
    BES08_09250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AOR76915
UniProt: A0A031JU28
Position
complement(1986339..1986716)
Genome map
AA seq 125 aa AA seqDB search
MSKQAAPRRVGDKEALAVNTNIRGSAQKLNLVAALIRGMRAEDAMNVLAFSKKAMAVDAR
KVLASAIANAENNHNLDVDALVVAEASVGKSVTMKRFHARGRGKSTRILKPFSRLRIVVR
EVEEA
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagcaagcagcaccccgccgcgtaggtgacaaggaagctcttgcggtcaacacg
aacattcgtggttcggcccagaagctcaaccttgtcgctgccctgatccgcggcatgcgc
gcggaagacgcgatgaacgtcctggccttctccaagaaggccatggcggtcgacgcccgc
aaggttctcgcctcggcgatcgccaacgcggaaaacaaccacaacctcgacgtcgacgct
ctcgtcgtcgccgaggcgtcggtcggcaagtcggtgaccatgaagcgtttccacgctcgt
ggtcgcggcaagtccacgcgcatcctgaagccgttttcgcgcctgcggatcgtcgttcgc
gaagtcgaggaggcctga

DBGET integrated database retrieval system