KEGG   Novosphingobium resinovorum: BES08_14905Help
Entry
BES08_14905       CDS       T04490                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
nre  Novosphingobium resinovorum
Pathway
nre00260  Glycine, serine and threonine metabolism
nre01100  Metabolic pathways
nre01110  Biosynthesis of secondary metabolites
nre01120  Microbial metabolism in diverse environments
nre01130  Biosynthesis of antibiotics
nre01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BES08_14905
Enzymes [BR:nre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BES08_14905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AOR78706
UniProt: A0A1D8A9E7
Position
3190747..3191742
Genome map
AA seq 331 aa AA seqDB search
MQFTSDNAAAVHPAVWKAMMAADAPDAPYDNDALSQRLDATFSALFGRECAVLWVASGTA
ANCLALAAMVPPHGAVVCHREAHIEMDEAGAPGFFLHGAKLLLADGASAKVTPETLAAVI
DPIRDDVHQVQPHAISITQASEYGCVYRPEEVAAIAAFAQARGLGLHMDGARFGNATAYL
GCSPAEAAGAVDALSFGFVKNGGMGAEAIVFFDVEAARTIRYRRKRAGHLQSKGRFMAAQ
ILAMLEGGLWLGNARAANAAAAEIAAAVPGRLLHPVEANEIFLTCTAAEREALRAQGFAF
YNWGADAARLVTSWDAKDAHVSALARALAGL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcacgtccgacaatgccgccgccgtccatcctgccgtctggaaggcgatgatg
gccgccgatgcgcccgacgcgccctatgacaacgacgcgctgagccagcgcctcgacgcc
acgttctcggcgttgttcgggcgcgagtgcgcggtgctgtgggtggcgagcgggaccgcg
gccaactgccttgccctcgccgccatggtgccaccgcacggcgccgtcgtctgccaccgc
gaggcgcatatcgagatggacgaggcgggtgcgccgggcttcttccttcacggcgccaag
ctgctgctggcggacggggccagcgccaaggtcacgcctgaaaccctcgccgccgtgatc
gatccgatccgcgacgacgtccatcaggtccagccccatgcgatctcgatcacgcaggcg
agcgagtacggctgcgtctatcgtcccgaggaagtcgccgcgatcgccgctttcgcgcag
gcgcgcggccttggcctgcacatggacggcgcgcgcttcggcaatgcgacggcgtatctg
ggctgctctcccgccgaggccgcaggcgcggtcgatgcgctgagcttcggcttcgtcaag
aacggtggcatgggcgcggaggccatcgtcttcttcgacgttgaggccgcgcgcacgatc
cgctaccgccgcaagcgcgccgggcacctgcagtccaagggccgcttcatggccgcgcag
atcctcgcgatgctggagggcggcttgtggctgggcaacgcgcgcgccgccaatgccgcc
gccgccgaaatcgccgctgccgtgccgggccgcctgctccatccggtagaggccaacgag
atcttcctcacctgcaccgccgccgagcgcgaggcgctgcgtgcgcaaggcttcgccttc
tacaactggggcgccgatgccgcgcggctggtgacgtcgtgggatgcgaaggacgcgcac
gtctccgctctcgccagggcattggccgggttgtga

DBGET integrated database retrieval system