KEGG   Novosphingobium resinovorum: BES08_22630Help
Entry
BES08_22630       CDS       T04490                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
nre  Novosphingobium resinovorum
Brite
KEGG Orthology (KO) [BR:nre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BES08_22630
Enzymes [BR:nre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     BES08_22630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AOR79594
UniProt: A0A031JDT9
Position
pSA1:1176397..1178538
Genome map
AA seq 713 aa AA seqDB search
MFEAKVLRGGIAVALTWSLAACGSADQQALAGKGAPEGWERQLDDASDGDDWPAFGRTYG
EQHYSPLDQVNAGNVKDLGLVWAVDLPAGNPATGPIEVGGTVYLASGYSVVRAIDVASGK
VKWEHDPKAPEASGIRLRQGWGSRGIAYWNHKVITATQDGRLLALDEKTGKPVWTVQTLE
EGAPMFISGPPRVFDGKVIIGNAGSDESAVRGFVTAFDADSGRQLWKFYTVPGDPAKGFE
DETQKMAAKTWSGDWWKYGGGGSVWNAITYDKANDQILLGTGNGAPWNHKIRSLGKGDNL
FVCSIVALDAKTGKYKWHYQINPGESWDFNAAMDMELADLTIDGKPRQVVMTAPKNGFYY
VIDRKDGKLISAEPFVEVTWAKKIDLATGRPVENPGVRYESGRTSFRPTPLGAHSWMPMA
YSPKTKLTYIPAIDLQAHFDDTGITRENFKFAEGMGLSPGVGYAIDAGGKDVTGWLVAWD
PVAQKARWKLPMPTHGNGGIMATGGNLVFQGRPDGGFSAYNAEDGKRLWNFDARAGVVAP
PITYRVNGKQYVTVIAGIGTSVGLFGPMFAQYGIDYRTQARRVLTFAIGGKQQLPPREPY
KAVAFEDADFKPDAGKAARGEGIFGGRCAVCHGTSVIAGGTAPDLRTSPIPANAEAFAEV
VRNGALVPAGMPRFGEFTPDQVEALRQYIRTRAEVLRSGRPDSSVGSAHKTGE
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaggcaaaggtgctgcgcggcgggattgccgtcgcgctgacgtggtcgctcgcg
gcctgcggatcggcagatcagcaggcgctggcgggcaagggcgctcccgaggggtgggag
cgccagctagacgatgccagtgacggcgacgactggcccgccttcggccgcacctacggc
gagcagcactacagcccgcttgatcaggtcaacgccgggaacgtcaaggatctcggcctc
gtctgggcggtggaccttccggcgggcaaccccgcgaccgggccgatcgaggtgggcggc
acggtctatctcgccagcggctattcggtggtccgcgcgatcgacgtcgcttccggcaag
gtgaaatgggaacacgatcccaaggcccccgaagcctccggcatccgcctcaggcagggc
tggggcagtcgcggcatcgcttactggaaccacaaggtcatcaccgccacgcaggacggc
cgcctgctcgcgctcgacgagaagaccggcaagccggtctggaccgtgcagacgctggag
gagggcgcgccgatgttcatctccggtccgccgcgcgtgttcgatggcaaggtgatcatc
ggcaatgccgggtccgatgaaagtgcggtgcgcggcttcgtcaccgccttcgatgcggac
agcggcaggcagctctggaagttctacaccgtccccggcgacccggcgaagggcttcgag
gacgagacgcagaagatggccgctaagacctggagcggcgactggtggaagtacggcggc
ggcggttcggtatggaacgccatcacttacgacaaggccaacgaccagatcctgctcggc
accggcaacggcgcgccttggaaccacaagatccgttctctgggcaagggcgacaacctg
ttcgtctgctcgatcgtcgcgctcgatgcgaagacgggcaagtacaagtggcactaccag
atcaaccccggcgaaagctgggacttcaacgccgcgatggatatggaactggccgacctg
accatcgacggcaagccgcgtcaggtggtgatgacggcgccgaagaacggcttctactac
gtgatcgaccggaaggatggaaagctgatctcggccgagcctttcgtggaagtgacgtgg
gcgaagaagatcgaccttgccaccggccgtccggtcgagaaccccggcgtgcgctacgaa
agcggcaggacttcgttccgccccacgccgctcggcgcgcatagctggatgccgatggct
tacagcccgaagacgaagctgacctatattcccgccatcgatttgcaggcgcacttcgac
gacaccggcatcacccgggaaaacttcaagttcgccgagggcatgggactgtctccgggc
gtcggctacgcgatcgacgcggggggcaaggacgtcaccggctggctcgtcgcctgggac
ccggtggcgcagaaggcgcgctggaagctgccgatgcccacacacggcaatggcggcatc
atggcgacgggcggcaatctcgtgttccaggggcggcccgacggcggcttttcggcctat
aacgccgaggacggcaagcgcttgtggaacttcgacgcccgcgcgggcgtggtggcgccg
ccgatcacttaccgggtaaacgggaagcagtacgtcacggtaatcgccgggatcggcacc
agcgtcggcctgttcggcccgatgttcgcgcagtacggcatcgattatcgcacgcaggcg
cgccgggtgctgactttcgcgatcggcggcaagcagcagttgccgccgcgcgaaccttac
aaggccgtcgccttcgaggatgccgacttcaagccggacgcaggcaaggccgcgcgcgga
gaaggcatcttcggcggtcgctgtgcggtctgccatggcacctcggtcatcgccgggggc
actgcgccggacctgcgcacttcgccgatccccgccaatgccgaggctttcgccgaagtc
gtccgcaacggcgcgctggtcccggcgggaatgcccaggttcggtgaattcacgccagat
caggtcgaagccctgcgccagtatatccgcacgcgggccgaagtcctgcgcagcggccgc
cccgacagttcggtcggttcggcacacaagaccggagagtga

DBGET integrated database retrieval system