KEGG   Novosphingobium resinovorum: BES08_23055Help
Entry
BES08_23055       CDS       T04490                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
nre  Novosphingobium resinovorum
Pathway
nre00620  Pyruvate metabolism
nre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BES08_23055
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nre02000]
    BES08_23055
Enzymes [BR:nre01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     BES08_23055
Transporters [BR:nre02000]
 Other transporters
  Primary active transporters [TC:3]
   BES08_23055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: AOR79669
UniProt: A0A031JD94
Position
pSA1:1287517..1288974
Genome map
AA seq 485 aa AA seqDB search
MAHIQFLDETLRDGQQSLWGMRMQAGMALPVAPLIDRTGYQIISLAGSSLFEVLIRHCQE
DPWAGLDLLVKAMPDTPLRAGCRSNGSVTFGFTPDALMDIWVDRLCAHGIRSFWLYDVLF
NIDKMHRLARIAKRHQCQVAGTMLFTLSPVHDDAYYADKADKLSALDEVDSLLLYDTGGV
LDRDRISTLVPAIKAKARGKPIEMHANNMLGQSAKSYIDAIEFGVTTIHTAVRPMANGPS
IPSVEIMARNVEMLGHTHNLDTSLFKPVADHFEKVGKAAGFLVNQHFEYDVTSLKHQIPG
GMMGTLRAQLVQQNMLDRLPDVLEEVARVRRELGYPGMATPFAQLVGTLAVLNIVTGKRY
SVVPDEVIQYAAGFYGEPVAPIDADVLDRILSKPRAKEILASPPEQPDREELHRRHGTGG
DDDELLLRALVPSADIDRMRLSGAPRRDYPTLSSPELDQVARLMKVANLPLVQLRSSQLE
LSMRQ
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatatccagttcctcgacgaaaccctgcgcgacggccagcagagcctgtggggc
atgcgcatgcaggcgggcatggccctgccggtggcgccgctgatcgacaggaccggctat
cagatcatcagcctggccggttcctcgctgttcgaagtgctgatccggcattgccaggaa
gacccctgggcgggcctcgacctgctggtgaaggcgatgccggacacgcccctgcgcgcc
gggtgccgctccaacgggtcggtgactttcggcttcacgcccgatgcgctgatggacatt
tgggtggatcgcctctgcgcccacggcatccgcagcttctggctctacgatgtgttgttc
aacatcgacaagatgcaccgtctcgcccgcatcgccaagcggcaccagtgccaggtggcg
ggcacgatgttgttcacgctctccccggtccacgacgatgcctattacgcggacaaggcg
gacaagctttcggcgctggacgaggtggacagcctgctgctctacgacaccggcggcgtg
ctcgatcgagaccggatttccacgctggtccctgcgatcaaggccaaggcgcgcggcaag
ccgatcgagatgcatgccaacaacatgctcggccagtcggccaagtcctatatcgacgcg
atcgagttcggggtgacgacgatccacaccgccgtgcgcccgatggccaacggtccctcg
atcccctcggtcgagatcatggcccgcaatgtcgagatgctgggccacacccacaacctc
gacacgtcgctgttcaagccggtggccgatcacttcgagaaggtcggcaaagcggccggg
ttcctggtgaaccagcatttcgagtacgacgtcacttcgctcaagcaccagatcccgggc
ggcatgatgggcaccctgcgcgcacagctggtacagcagaacatgctggatcgcctgccc
gacgtgctggaggaagtcgcgcgcgtgcgccgcgaactgggctatcccggcatggcgacg
ccgttcgcgcagctggtcggcacgctggcggtgctcaacatcgtgacgggcaagcgctac
tcggtggtgccggacgaagtgatccagtacgcagccggtttctatggcgagcccgtcgcg
ccgatcgacgccgatgtgctggaccgcatcctgtcgaaaccgcgcgccaaggaaatcctc
gccagcccgcccgaacagcccgaccgcgaggaactgcatcgccgccacggcaccggcggg
gatgacgacgaactgcttctgcgcgcgctagtgccgtccgccgacatcgaccgcatgcgc
ctttcgggagcgccgcgccgggactatccgacgctgtcctcgcccgaactggatcaggtg
gcccggctgatgaaggtggcgaacctgccgctggtgcagctgcgctccagccagctcgaa
ctctcgatgcggcagtag

DBGET integrated database retrieval system