KEGG   Novosphingobium resinovorum: BES08_25170Help
Entry
BES08_25170       CDS       T04490                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nre  Novosphingobium resinovorum
Pathway
nre00071  Fatty acid degradation
nre00072  Synthesis and degradation of ketone bodies
nre00280  Valine, leucine and isoleucine degradation
nre00310  Lysine degradation
nre00362  Benzoate degradation
nre00380  Tryptophan metabolism
nre00620  Pyruvate metabolism
nre00630  Glyoxylate and dicarboxylate metabolism
nre00640  Propanoate metabolism
nre00650  Butanoate metabolism
nre00900  Terpenoid backbone biosynthesis
nre01100  Metabolic pathways
nre01110  Biosynthesis of secondary metabolites
nre01120  Microbial metabolism in diverse environments
nre01130  Biosynthesis of antibiotics
nre01200  Carbon metabolism
nre01212  Fatty acid metabolism
nre02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BES08_25170
   00630 Glyoxylate and dicarboxylate metabolism
    BES08_25170
   00640 Propanoate metabolism
    BES08_25170
   00650 Butanoate metabolism
    BES08_25170
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BES08_25170
   00072 Synthesis and degradation of ketone bodies
    BES08_25170
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BES08_25170
   00310 Lysine degradation
    BES08_25170
   00380 Tryptophan metabolism
    BES08_25170
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BES08_25170
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BES08_25170
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BES08_25170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nre04147]
    BES08_25170
Enzymes [BR:nre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BES08_25170
Exosome [BR:nre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BES08_25170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AOR80216
UniProt: A0A1D8ADM2
Position
pSA2:complement(35354..36529)
Genome map
AA seq 391 aa AA seqDB search
MPEAYIVSARRTAGGRRKGRLASWHPADLGALVLDALVAESGVDPAAIDDVIIGCVSQVG
EQTFAFGRNVVLASGLPDSVPAVTIDRQCGSSQQALHFAAQAVMSGMQDIVIAGGVESMT
RVPMGSAITLAQAGGIGADPFPASIKERFGVDWFNQFVGAQMIADKYGFTREQHDRFALE
SHRRAAAAADSGAFAAEIVPVPVTDAEGQQIVHDRDEGIRADSTLESIGSVKLLSETGTL
SAATASQICDGASGVLIASEAAVKAHGLTPIARVVNLAVTAGDPVIMLEEPIPATRRVLQ
RAGLTMADIDLFEVNEAFASIPMAWAQALDADPARLNVNGGAIALGHPLGATGTKLTATL
IHALKARGGRYGLQTMCEGGGISNASVFEVL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagcctatatcgtttccgcccggcgcactgcaggcggccgccgcaaaggtcgt
ctggccagttggcacccggcagatctgggcgcgcttgtgctcgatgcgctggtggcggaa
agcggcgtcgatccggcggcgatcgatgacgtcatcatcggctgcgtcagtcaggtgggc
gagcagacctttgcctttggccgcaacgtggtgctggcatccggccttcccgacagtgtt
ccggcggtgaccattgaccgacagtgcggttcgtcccagcaggcgctgcatttcgccgcg
caggccgtcatgtcgggcatgcaggacatcgtcatcgcaggcggcgtcgagagcatgacg
cgcgtgccgatgggttccgcgatcacgctggcgcaggcgggcggcatcggcgccgatccc
ttcccggcctcgatcaaggagcgtttcggggtggactggttcaaccagttcgtcggcgcg
cagatgatcgccgacaagtacggcttcacgcgcgaacagcacgaccgcttcgctcttgaa
agccatcgccgggcagccgctgctgccgacagcggtgccttcgccgcagagatcgtgccg
gtgccggtcaccgatgctgaagggcagcagatcgtccatgaccgcgatgaaggcattcgc
gcggattcgacgctggaatcgatcggctcggtcaagctcctgagcgagacggggacgctg
agcgccgccacggcgagccagatctgcgatggcgccagcggtgtcctcatcgcatcggaa
gcggcggtgaaggcccatggcctcacccctatcgcgcgcgtggtgaaccttgcggtgacc
gcgggcgacccggtcatcatgctggaggagccgatccccgcgacgcgccgggtgctgcag
cgcgcgggcctgaccatggccgacatcgacctgttcgaggtgaacgaggcctttgcttcg
atcccgatggcctgggcgcaggcactcgatgccgatcccgcgcggctcaacgtcaatggc
ggagcgatcgcattgggtcacccgctcggtgcaaccggcaccaagctgacggccacgctg
atccatgcgctgaaggccaggggcggccgttatggtctccagacgatgtgcgagggcggt
ggcatctccaacgcctcggtcttcgaggttctttga

DBGET integrated database retrieval system