KEGG   Novosphingobium resinovorum: BES08_26300Help
Entry
BES08_26300       CDS       T04490                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
nre  Novosphingobium resinovorum
Pathway
nre00625  Chloroalkane and chloroalkene degradation
nre00680  Methane metabolism
nre01100  Metabolic pathways
nre01120  Microbial metabolism in diverse environments
nre01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nre00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BES08_26300
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BES08_26300
Enzymes [BR:nre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BES08_26300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N Glu_dehyd_C HI0933_like AlaDh_PNT_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AOR80392
UniProt: A0A1D8AE47
Position
pSA2:265277..266416
Genome map
AA seq 379 aa AA seqDB search
MKAVVYNGPKDVSVNTIDDPKIEKQTDVIIRLTTTNICGSDLHMYEGRTSFEKGRVFGHE
NLGEVIEVGAAVDRIKKGDRVCMPFNVGCGFCENCERGLTGFCLTTNPGTAGAAYGFAEM
GPWQGGQAELMRVPYADFNCLKLPEDAEEKEDDYVMLSDIFPTGWHGVELSGFLPGESIA
IYGAGPVGLMAAHSAEIRGASQIFVVDSHDDRLKLAEAIGAIPIDMRKGDPAQQILDATG
GLGTDRGVEAVGYQCCDRHGKERSNYTMNCLVKSTKATGGIGVVGVFVPEDPNAPDDLQK
EGKMAFDFGNFWFKGQKIGTGQCNVKHYNRRLMKLIEQGRGNPAQIISHRLPLDQAPDAY
KHFDERDAGWTKVVLKPGT
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctgtcgtgtacaacgggcccaaagatgtttctgtgaataccatcgatgatccc
aagatcgaaaagcagaccgatgttatcatccggctgaccacgaccaatatctgcgggtcg
gaccttcacatgtacgagggccgtaccagctttgagaagggcagggtcttcggtcacgaa
aaccttggcgaggtcatcgaagtcggcgctgccgtagatcgtatcaagaagggcgatcgc
gtgtgcatgccgttcaacgtcggttgcggtttctgcgaaaattgcgaacgcggtttgacg
ggtttttgcctcacgaccaaccctggaaccgccggcgcagcgtatggatttgccgagatg
ggtccgtggcaaggtggtcaggccgagttgatgcgcgttccttatgcggacttcaattgt
cttaagctgcctgaggacgctgaggagaaggaggatgactatgtcatgctctccgacatc
ttccccaccggttggcatggcgtcgaactgtcaggtttcctgcctggcgaaagcatcgcg
atctacggcgccggtccggtcggtttgatggccgcgcactcagccgaaatccgcggtgcc
tctcagatcttcgtggtcgattctcacgatgaccgcctgaaactggccgaggcgataggc
gctattccgatcgacatgcgcaagggcgatcccgcccagcagatccttgacgcgaccggc
ggcctcgggactgaccggggggtcgaggcggtcgggtatcagtgttgcgatcgccacggc
aaggaacgcagcaattacacgatgaactgcctcgtcaaaagcacgaaggccactggcgga
atcggcgtcgtcggcgtgttcgttccggaagacccgaacgcgcccgacgatcttcagaag
gaaggcaagatggcgttcgactttggcaacttctggttcaagggccagaagatcggcacc
ggccagtgcaatgtaaagcactacaaccggcgattgatgaagcttatcgagcaaggccgg
ggcaatcctgcccaaatcatctcgcaccgactgccgcttgatcaggcaccagacgcctac
aagcatttcgacgagcgcgatgctggttggacgaaggtcgtgctcaagccgggcacctga

DBGET integrated database retrieval system