KEGG   Novosphingobium resinovorum: BES08_27365Help
Entry
BES08_27365       CDS       T04490                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nre  Novosphingobium resinovorum
Pathway
nre00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BES08_27365
Enzymes [BR:nre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BES08_27365
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BES08_27365
    1.1.1.-  
     BES08_27365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C FAD_binding_3 DAO Pyr_redox_3 FAD_binding_2 Pyr_redox_2 Shikimate_DH 2-Hacid_dh_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AOR80975
UniProt: A0A1D8AFT9
Position
pSA2:complement(499215..500243)
Genome map
AA seq 342 aa AA seqDB search
MKAAVFVGAGRPLAIQQIDVPRPGPGQLLVRVKRCGVCGSDLHLTEAHAAWQVPHGTVLG
HEFAGEIVELGEGTSDIWREGDRVAALPYVGCGRCRECLNGYPFHCPETLSLATGDLIGA
FSEYAVIGARETARVSEHLSWEQAAFTEPVAVGIRAVACAGITLGARVLIVGAGPIGLSA
AACAKLSGAGAVVVCARTDRHADRAVAMGATEFLLNDADLRRNFIRHAGGPPEIVIECAG
VPGMLDLCCDLAEKRGRVVIAGGCNGKDPLNVLTPLCKELTFRFAVCYTIREFALAERLI
ASARINPMPMYDGEVSLHQLPARFEELRRNKDACKLMVNLDA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggccgttttcgttggcgccgggcgtccgctcgccatccagcagatcgacgtg
ccgcgtcccggcccaggccagttgctggtgcgggtgaagcgctgcggcgtttgcggcagc
gacctgcacctgaccgaagcgcacgcggcctggcaggtgccgcacggaacggtgctgggg
cacgaattcgccggagagatcgtcgaactgggggaaggaacctccgacatctggcgcgag
ggcgaccgcgtcgccgcgctgccctatgtcggctgcgggcgctgccgggaatgccttaac
ggctaccccttccattgtccggaaaccctcagcctggccacgggcgacctcatcggggct
ttcagcgaatatgccgtgatcggcgcccgggaaaccgcacgcgtttcggagcatctcagc
tgggagcaggccgcattcactgaaccggttgcggtgggcatccgggccgtcgcctgcgcg
gggatcactctgggcgcgcgggtgctgatcgtaggagccgggccgatcggcctcagcgca
gccgcctgcgcgaagctctccggtgcgggggcagtcgtcgtgtgcgcgcgcactgatcgc
catgccgaccgtgctgtcgcgatgggtgccactgagttcctgctgaacgatgcggacttg
cgccgcaatttcatccgccatgcgggcggccctccggaaatcgtaatcgaatgcgccgga
gttcccggcatgctcgatctgtgctgcgatctggccgagaaacgcggccgcgtcgtcatc
gccggtggctgtaacggcaaggacccgctcaatgtgctcaccccgctgtgcaaggaactc
accttccgtttcgcagtctgctacaccatccgcgaattcgcactggcagagcggctgatc
gcctcggcccggattaatccgatgccgatgtacgacggcgaagtctcactgcaccagttg
cccgcccggttcgaggaactgcgccgcaacaaagatgcctgcaaactgatggtgaacctt
gatgcctga

DBGET integrated database retrieval system