KEGG   Neorickettsia risticii: NRI_0525Help
Entry
NRI_0525          CDS       T00951                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nri  Neorickettsia risticii
Pathway
nri00020  Citrate cycle (TCA cycle)
nri00310  Lysine degradation
nri01100  Metabolic pathways
nri01110  Biosynthesis of secondary metabolites
nri01120  Microbial metabolism in diverse environments
nri01130  Biosynthesis of antibiotics
nri01200  Carbon metabolism
Module
nri_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nri_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nri00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NRI_0525 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    NRI_0525 (sucB)
Enzymes [BR:nri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NRI_0525 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 HlyD_3 BCDHK_Adom3
Motif
Other DBs
NCBI-ProteinID: ACT69504
UniProt: C6V539
Position
complement(489171..490454)
Genome map
AA seq 427 aa AA seqDB search
MKEVLVPRMGESIAEASVVKITKNIGDSVREDELLFELETDKAAVEVSAPVSGVLSKINV
EVGQAVKVDDVLGLIDENVVASDGGSPISPGVDGGNIVPPSVAIAGGTALGVSTGKDVSS
LQSSELVYAKQDAPSARILLEEKSLSPRDIVGTGKDNRIRKVDVLSRLFYGDPAQKQDSE
SEQRAVAGSGSLAPKFPERLVPLSKLRQRIASRLKESQNTAAILTTFNEVDMENVIQIRK
RYKDSFEKVHGLKLGFMSFFVQAVICGLEAFPEINAEIRGKDIVYKDYYNIGVAVGTKNG
LVVPVIKNAQNLSFAEIERQILEYGKKARDGKIEPDDMQGGTFTISNGGIYGSLMSTPII
NPPQSGILGMHAIKERPVVIDGAIVVRPMMYLALSYDHRIVDGREAVSFLVRVKECLENP
ERLLLKV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttctcgtcccaagaatgggtgaatcaattgcggaggcatccgttgtgaaa
attactaaaaatatcggtgattccgtgagggaggacgagttactttttgagcttgaaacc
gataaggcagccgtagaagtatctgctcctgtttctggagttttgagtaaaatcaatgtt
gaggtagggcaagcggtgaaagtagacgatgttctcgggttaatcgacgaaaatgttgtt
gcttccgatggaggcagcccaatttcacctggggttgatggtggtaatatcgttccacca
tctgttgccattgcaggaggaactgcattaggtgtaagcacaggaaaggatgtttcatcg
ctgcaatcttctgagttagtttatgcaaagcaggacgcaccatctgcgcgaattctgctg
gaagagaagtcgttatccccaagggatattgttggtactgggaaagataacaggataagg
aaagttgatgtattaagtcgacttttttacggtgatccagcccaaaaacaagattcggaa
tcagaacagcgtgcagttgctggtagtggttctttagctcctaagttccctgaaaggctt
gtaccgctgtctaagttgagacaaagaatcgcatcgagactgaaggaatcacaaaataca
gctgcaattttaacgactttcaatgaagtggatatggagaatgtcattcaaataagaaag
cgttacaaggattcctttgaaaaggtccatggcttgaaacttggctttatgtcgtttttt
gtacaagctgttatttgtgggcttgaagcttttccggaaattaatgccgagattcgtgga
aaggacatagtttacaaagattactataatatcggggttgccgttggtacaaagaatggt
cttgttgtgccagtaataaaaaatgcgcagaatctttcctttgcagaaattgaaagacaa
atacttgaatacggaaaaaaggctagggatggcaaaatagagccagacgatatgcagggt
ggtactttcaccatttctaatggtggtatttatggttcactcatgtcaacgccaattatt
aatcctccacaatctggcatacttggaatgcacgcaataaaagaaaggcctgttgttatt
gatggcgcgattgttgtgcggccaatgatgtatcttgctctctcttatgatcaccgtata
gttgatggtagggaggcagttagcttccttgttcgtgtgaaagagtgtttggaaaatcct
gagaggctcttactcaaagtctag

DBGET integrated database retrieval system