KEGG   Nitratifractor salsuginis: Nitsa_0359Help
Entry
Nitsa_0359        CDS       T01405                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nsa  Nitratifractor salsuginis
Pathway
nsa00020  Citrate cycle (TCA cycle)
nsa00640  Propanoate metabolism
nsa00660  C5-Branched dibasic acid metabolism
nsa01100  Metabolic pathways
nsa01110  Biosynthesis of secondary metabolites
nsa01120  Microbial metabolism in diverse environments
nsa01130  Biosynthesis of antibiotics
nsa01200  Carbon metabolism
Module
nsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nitsa_0359
   00640 Propanoate metabolism
    Nitsa_0359
   00660 C5-Branched dibasic acid metabolism
    Nitsa_0359
Enzymes [BR:nsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Nitsa_0359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A DHHA1
Motif
Other DBs
NCBI-ProteinID: ADV45629
UniProt: E6WZX1
Position
369940..371112
Genome map
AA seq 390 aa AA seqDB search
MNIHEYQAKEIFRKYNVPVPRGKVAFTVDEAVEAAKELGGNLWVVKAQIHAGGRGLGGGV
KLAKSIDEVRHWADEILGMTLVTHQTGPEGKVVHKVYIEEGADIAKEFYLGMLLDRAAEM
PVMMASTEGGMEIEKVAAETPEKIVKVTIDPTIGFQGFHGRKLAFGLGLPKEEIGTFIKF
ASALYNAYMDNDAEMIEINPLIKTGDGKFLALDAKMGFDDNALYRHPDISEMRDLEEEEP
TELEAKAHGLSYIKLDGNVGCMVNGAGLAMATMDIIKHEGGEPANFLDVGGGANPETVAK
GFEIILKDPNVKAIFVNIFGGIVRCDRVANGILEATKITDVNVPVVVRLDGTNADEAAEI
LKNANIENIIAAENLADGARKAVAAAKGEL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattcatgagtatcaggcgaaagagatcttccgcaagtacaacgtccccgtaccc
cgcggaaaagttgccttcaccgtcgatgaggcggtggaagcggccaaagagctgggaggg
aatctctgggtagtcaaagcccagatccatgccggaggccgtggactcggcggcggggtc
aagctggccaagtccatcgacgaagtgcgccattgggccgatgaaatcctcggaatgacc
ctggtgacccatcagaccgggcccgaagggaaagtggtccacaaggtctatatcgaagag
ggtgccgacatcgccaaagagttctatctgggaatgctcctggaccgcgcggcggagatg
ccggtcatgatggcgtccaccgaagggggaatggagattgagaaggtcgcggccgaaacc
cctgaaaagatcgtcaaggtcaccatcgaccccaccatcggcttccagggattccacggg
cgcaagctggcctttggcctcggtctgcccaaagaggagatcgggactttcatcaaattc
gcttcggcgctctacaacgcctatatggacaacgacgccgagatgatcgagatcaacccc
ctgatcaagaccggagacgggaagtttctggcgctcgacgccaagatgggcttcgatgac
aatgcgctctaccgccatccggacatttcagagatgcgggacctcgaagaggaagagccc
accgagctcgaagccaaagcgcacggcctgagctacatcaagctcgacggcaatgtcggc
tgtatggtcaacggtgccggactggcgatggcgacgatggatatcatcaagcacgaaggg
ggcgagccggccaacttcctcgacgtgggaggcggggccaaccccgaaacggtcgcgaaa
ggcttcgagatcattctcaaagatcccaacgtcaaagcgatcttcgtcaacatcttcggc
gggatcgtccgctgcgaccgggttgccaacggcattctcgaagcgaccaagatcaccgat
gtgaatgtgcctgtggtcgtgcgcctggacggtaccaacgccgatgaagccgcagagatt
ctcaaaaacgccaatatcgaaaacatcattgccgccgaaaatcttgccgatggtgcccgc
aaagccgtcgccgctgcgaaaggagagctctaa

DBGET integrated database retrieval system