KEGG   Nitratifractor salsuginis: Nitsa_0486Help
Entry
Nitsa_0486        CDS       T01405                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine/D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
nsa  Nitratifractor salsuginis
Pathway
nsa00471  D-Glutamine and D-glutamate metabolism
nsa00550  Peptidoglycan biosynthesis
nsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Nitsa_0486
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nitsa_0486
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nsa01011]
    Nitsa_0486
Enzymes [BR:nsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Nitsa_0486
Peptidoglycan biosynthesis and degradation proteins [BR:nsa01011]
 Precursor biosynthesis
  Amino acid ligase
   Nitsa_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ADV45756
UniProt: E6X0N6
Position
complement(499056..500339)
Genome map
AA seq 427 aa AA seqDB search
MHLSFFGYGKTTRAIAARFGGGFDFYDDRCEKPYVDEAGNRIHPSRDFAPEQSALEILTP
SIRPDSPLLAKARNPISEYDLFLSRKWIETLSEEQRRHLPSSIFNLLPKTPPRTVWISGT
NGKTTTTQMLTWLLEPHGALSGGNIGTPLADLDPEAPLWILETSSYTLHHTRYASPDLYL
LLPITPDHIDWHGSPEAYTADKLAPLRTMREGELALIPAGLPRPSSAAWVVEYDSNAYLE
SFFDLDASRLRYRAGFLQDALLALAVSRTLFDEADYDQLDAFRLDRHRQEEILDARGRLW
VNDSKATNLDAALQALEAYADRPIHLIAGGDDKGVDMTPLIRCLARLDAKLYTIGSNNRR
LSQLARDYGVPVQSFTHLDEALQAVDRALKPSEVALLSPAAASLDQFPSYAHRGDALVDY
VKKIEID
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcatctttcctttttcggttacggcaaaaccacccgggccatcgccgcacgttttggc
ggcggcttcgatttttacgatgaccgctgcgaaaagccttatgtagatgaagcgggcaac
cgcattcatccctctagagattttgctcccgagcagagcgccttggagatcctcaccccc
agcatccggcccgacagccccctgctggccaaagcacgaaacccgatcagcgaatacgac
ctttttctctcacgcaaatggatcgaaactctttcggaagagcaacgccgacatcttcca
tcttccattttcaatcttctgcccaaaacccctccccgcaccgtttggatcagcggcacc
aacggcaaaaccaccaccacccagatgctcacctggctcctggaaccccacggagcactc
agcgggggcaacatcggaacccctctggccgatctcgaccccgaagcacccctgtggatc
ctggagaccagctcctacaccctccaccatacccgctacgcctcccccgatctctatctg
cttctgcccatcacccccgatcacatcgattggcacggtagccccgaggcttataccgcc
gacaaattggccccgctgagaacgatgcgcgaaggcgagcttgccctgatccccgccggc
ctgcctcgaccctcgagtgccgcctgggtcgtggaatacgactccaatgcctacctcgaa
tcctttttcgacctcgacgcttcacggcttcgctaccgggcgggctttctccaggatgcc
ctattggccctggccgtcagccgtaccctcttcgacgaagccgactacgaccagctcgat
gccttccgcctcgaccggcaccgccaggaagagatcctcgatgcccggggccgcctctgg
gtcaacgactccaaagctaccaacctcgacgcagccctccaggcgttggaagcctatgcc
gaccgtcctatccatctcattgccggcggcgatgacaaaggagtcgatatgacccccctc
atccggtgcctcgcccggctcgacgccaaactctacaccatcggcagcaacaaccgccgc
cttagccaactggcccgagactatggagtcccggtacagagcttcacccatctcgacgaa
gcgctccaagctgtcgatcgagccctaaagccctcggaagtcgccctgctttcccccgcc
gccgccagcctggaccagtttccctcctatgcccaccgaggagatgccctggtcgattat
gtcaagaaaattgagatagattaa

DBGET integrated database retrieval system