KEGG   Nitratifractor salsuginis: Nitsa_1256Help
Entry
Nitsa_1256        CDS       T01405                                 

Definition
(GenBank) biotin/lipoyl attachment domain-containing protein
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
nsa  Nitratifractor salsuginis
Pathway
nsa00020  Citrate cycle (TCA cycle)
nsa00620  Pyruvate metabolism
nsa01100  Metabolic pathways
nsa01120  Microbial metabolism in diverse environments
nsa01200  Carbon metabolism
nsa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nitsa_1256
   00620 Pyruvate metabolism
    Nitsa_1256
Enzymes [BR:nsa01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Nitsa_1256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA Biotin_lipoyl HMGL-like Biotin_lipoyl_2 RnfC_N Amidohydro_1 GCV_H PYNP_C NFACT-R_2
Motif
Other DBs
NCBI-ProteinID: ADV46509
UniProt: E6WYJ7
Position
complement(1255211..1257022)
Genome map
AA seq 603 aa AA seqDB search
MAKKYIDVMDTSFRDGFQSVFGGRVLMEDFFPAVEAALEAGITHFEFGGGARFQTLYFYL
REDAFEMMDRFREMVGPNVNLQILARGINTVMLDTGSREMIDLFAKLFAKHGTTTVRNFD
ALNDVQNLQYSGACVKKHGMAHEVVVTMMDLPPGCKGAHDVAFYEKVLREILESDLVFDS
VAFKDASGTSNPHKVYETIRMARQLLGEDTHIRLHTHETAGVSVAGYLAALEGGANGIDL
AAAPVSGGTSQPDILTLMHALKGTDYDLGGLDLNKVRRYEKRFRECLKDYFIPPEATRVN
PIIPFAPMPGGALTANTQMMRDSGNLDKFDEVIEGMTEVVEKGGYGTSVTPVSQFYWQQA
YANVMFGPWKKIAPGYGKMVLGYFGRTPMPPDPEIVELAREQLHLEPTEENPLDIADRDE
KKSIAYWKAVLQAEGIEATEENIFIAAACDKKGIAYLKGESPLMVRKGAQNETKQSEGAE
MAGNYTVIVDGKKYSVQVSEGEGEITVQPAGESSASAKESPEAKPATPTGGKGTIEVEAQ
TPGTVWKILKKPGDHVDEGEPIMILEAMKMEIEVAAPMQGTVATIDVEPNEQIEEGRLLA
TLA
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaagtatatcgatgtgatggataccagtttccgggacggctttcagtcggtc
ttcggcgggcgggtgctgatggaagacttcttccccgcggtggaagcggctctggaagcg
gggatcacccacttcgagttcggcgggggtgcgcgtttccaaaccctctacttctatctc
cgggaagacgccttcgaaatgatggaccgtttccgggagatggtgggccccaatgtcaat
ctccagatcctcgctcggggaatcaatacggtgatgctcgataccggcagccgggagatg
attgacctcttcgccaaactcttcgccaagcacgggaccacgaccgtgcgcaacttcgac
gccctgaacgatgtgcagaacctccaatacagcggcgcctgcgtcaaaaagcacggcatg
gcccacgaagtggtggtgacgatgatggatctgccgccgggctgcaagggagcgcacgat
gtagccttctacgaaaaggtgctccgggagattctcgagagtgacctggtcttcgacagt
gtggccttcaaagacgccagcggcacttccaacccccataaagtctacgagacgatccgg
atggcacggcagcttctgggagaagatacccatatccgcctccatacccacgaaacggcc
ggagtgagtgtcgccggctacctggcggctctggaggggggcgccaacggtatcgacctg
gcggcggcacccgtgagcggcggaacttcccagcccgacatcctgaccctgatgcatgcc
ctcaaagggaccgactacgatctgggcggcctcgatctgaacaaggttcggcgctatgaa
aagcgctttcgggagtgcctgaaagattatttcatcccgcccgaagcgacccgggtcaat
cccatcatccctttcgccccgatgcccggaggtgccctcactgccaatacccagatgatg
cgcgacagcggcaacctcgacaaattcgacgaagtgatcgaagggatgaccgaggtggtg
gagaaggggggctacggcacttcggtgacgccggtgagtcaattctattggcagcaggct
tacgccaacgtgatgttcggcccctggaagaagattgcccccggatacggcaagatggtg
ctgggctatttcggccgcaccccgatgcctcccgatcccgagatcgtggagctggcccga
gagcagctccatctggaaccgaccgaggagaatcccctggatatcgccgaccgggacgaa
aagaaatccatcgcctactggaaagcggtgctccaggccgaggggatcgaagcgacggag
gagaatattttcatcgcggcggcctgtgacaagaaggggatcgcctacctcaaaggggaa
tcgccgctgatggtgcgcaagggtgcccaaaacgaaacgaagcaaagcgagggagcagag
atggcagggaattacaccgtaatcgtcgacggcaagaagtacagtgtgcaggtgagcgaa
ggggaaggggagatcacggtccagccggccggggaatcctccgcttccgccaaagagagc
ccggaggccaagccggcgactcccaccggcggcaaagggacgatcgaagtggaggcccaa
actcccggtaccgtctggaagatcctcaaaaaacccggcgatcatgtcgacgagggggag
ccgattatgatcctggaggcgatgaagatggagatcgaagtggccgcgcccatgcagggg
accgtcgccaccatcgatgtggaacccaacgaacagatcgaggaggggcgtctcctggcg
acgctggcatga

DBGET integrated database retrieval system