KEGG   Nitratifractor salsuginis: Nitsa_2066Help
Entry
Nitsa_2066        CDS       T01405                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
nsa  Nitratifractor salsuginis
Brite
KEGG Orthology (KO) [BR:nsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Nitsa_2066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 FapA UPF0242 BRE1 HBM ADIP Atg14 SF-assemblin ACCA DUF5320 SlyX Spc7 APG6_N zf-C4H2 Cluap1 DUF4472
Motif
Other DBs
NCBI-ProteinID: ADV47307
UniProt: E6X394
Position
complement(2040142..2041725)
Genome map
AA seq 527 aa AA seqDB search
MEINTFEKIQKKTAKKTRNDFLKLGLSLIFMALVLLATWNKIPGNPFLAVAAVFGAYMAM
NIGANDVANNVGPAVGSKALSMMGAVILAAIFESAGALIAGADVTGTIKKGIIDPAAFAQ
PEYFVWAMTAALLAAALWLNLATWLKAPVSTTHSIVGGVMGGGIAAAGSFAIVHWGTMGK
IVASWIISPILGGLIAAGFLYAIKKTIFYQKDTKAAAMKMVPLYVAVMGWAFITYLIMKG
LKHLVKLGFPTAAAIGVLGAIAIFFGVKKAIAKYAHLVSDERESVNRLFTIPLIFAAALL
SFAHGANDVANAVGPLAGIYDALAHSAVSTKAAIPLWVMLIGALGISLGLALYGPKLIKT
VGSEITELDQARAFSIALAAAITVIIASQLGLPVSSTHIALGGVFGVGFLREWLDRTQRL
QYRIKEEREKIEALKRKLSALKEELKSLEAKEEKSHADYERIVHLFEAIEGMEKELKAET
KALKRVYKTRYVQRSAVKKIVAAWVITVPAAAVVSALIFYIIKGAML
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
gtggaaatcaacaccttcgaaaagatccagaaaaagacggccaagaagacccggaacgac
tttctgaagttgggcctctccctgatcttcatggccctggtgctgctggcaacctggaac
aagatccccggcaaccccttcctggccgttgccgcggtcttcggcgcctatatggcgatg
aacatcggggccaacgatgtggccaacaacgttggtccggcggtgggctccaaagccctg
tcgatgatgggagcggtgatcctggcggcgatttttgaatcggcgggagcgctcatcgcc
ggagcggatgtcaccggcaccatcaaaaaagggatcatcgatccggccgccttcgctcag
cccgagtatttcgtctgggcgatgaccgccgcgctgctggcggctgccctctggctcaac
ctggccacctggctcaaggcccctgtctccaccacccactccatcgtgggcggagtgatg
gggggcgggatcgccgccgccggtagcttcgccatcgtccactggggaacgatgggcaag
atcgtcgccagctggatcatctccccgatcctgggcggcctcatcgccgcgggtttcctc
tacgccatcaaaaagaccatcttttaccaaaaggacactaaagccgccgcgatgaagatg
gtccccctctatgtggcggtgatgggctgggctttcatcacctatctcattatgaagggg
cttaagcacctggtcaagctgggcttccccaccgcggcggcaatcggcgtgctgggagcg
atcgcgatcttcttcggcgtcaaaaaggcgatcgccaaatatgcccatctggtcagtgac
gagcgggagagcgtcaatcgcctctttaccattcccctcatctttgccgcggctctgctg
agcttcgcccacggcgccaacgacgtggccaacgccgtcggccccctggcggggatctac
gacgccctggcccactccgctgtctctaccaaggcggcgatccccctttgggtgatgctg
atcggtgctctggggatctccctggggctggccctctacggccccaagctcatcaaaacc
gtcggcagcgaaatcaccgagctcgatcaggcgcgggccttctctatcgctctggcggcg
gccatcaccgtcatcatcgcatcgcagctgggcttgccggtcagctccacccacatcgcc
ctgggcggggtcttcggtgtgggctttttgcgggagtggctcgaccgcacccagcgcctg
cagtatcgcatcaaagaggagcgtgagaagatcgaagccctcaagcgcaaactctccgct
ctgaaagaggagctcaagtccctggaggccaaagaggagaaatcccacgccgactatgag
cgcatcgtccatctcttcgaagccatcgagggtatggagaaggagcttaaggccgagacc
aaggctctcaaacgggtctataaaacccgctacgttcagcgcagcgccgtcaagaagatc
gtcgccgcctgggtcatcaccgtgcctgctgccgctgtggtttcggcattgatcttctat
atcatcaaaggggcgatgctctga

DBGET integrated database retrieval system