KEGG   Nonlabens sediminis: BST91_07515Help
Entry
BST91_07515       CDS       T04875                                 

Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
nsd  Nonlabens sediminis
Pathway
nsd00730  Thiamine metabolism
nsd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BST91_07515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nsd03000]
    BST91_07515
Enzymes [BR:nsd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     BST91_07515
Transcription factors [BR:nsd03000]
 Prokaryotic type
  Other transcription factors
   Others
    BST91_07515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: ARN71495
Position
1588140..1588793
Genome map
AA seq 217 aa AA seqDB search
MSNWYQQINKSTDSILAKIQNQPFIKELMQGTLPKDVFQFYINQDALYLAQYKKVLALVG
IKCRNENETQFFLDAATGIIHVENALHQHFVNADSFTTIASPTCELYTSYLSRIAHEKSI
TVSIAAVLPCFTIYKQIGDYILENQTNKDNNPYQEWINTYGGEEFAASVEQAINIANKYA
QTANQEELEMMNQAFLKASQLEWMFWDSAYRKEQWEI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattggtaccaacaaataaataaatccactgacagtattcttgctaagattcaa
aatcagcctttcataaaagaacttatgcaaggtacattacctaaagatgtatttcagttt
tacattaatcaagatgccttgtatttagcgcaatacaaaaaagttcttgcccttgtcgga
attaaatgccgtaatgaaaatgaaacccagttttttctagatgcagcaacaggaatcata
catgttgaaaatgctcttcatcaacattttgtaaatgccgattcgtttaccacaatagca
tcacctacttgtgagctttataccagttatttgtctagaattgctcatgaaaaatcaatt
acagtaagtatagcagctgttttaccatgctttaccatttacaaacaaataggcgattat
attcttgagaaccaaactaataaagataataatccttaccaagaatggattaacacctat
ggtggtgaggagtttgcagcatctgtagaacaagcaatcaatattgcaaacaagtatgca
caaacagctaatcaagaagaactcgaaatgatgaaccaagcctttttgaaagcttcacaa
ttagagtggatgttttgggatagtgcttatagaaaggaacaatgggaaatttaa

DBGET integrated database retrieval system