KEGG   Nonlabens sediminis: BST91_11930Help
Entry
BST91_11930       CDS       T04875                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
nsd  Nonlabens sediminis
Pathway
nsd00072  Synthesis and degradation of ketone bodies
nsd00280  Valine, leucine and isoleucine degradation
nsd00650  Butanoate metabolism
nsd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BST91_11930
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BST91_11930
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BST91_11930
Enzymes [BR:nsd01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     BST91_11930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C IF-2B
Motif
Other DBs
NCBI-ProteinID: ARN72320
UniProt: A0A090Q0Q7
Position
2606666..2607322
Genome map
AA seq 218 aa AA seqDB search
MSLDKTGIAKRIAQELQDGYYVNLGIGIPTLVANYIPEGVQVEFQSENGVLGMGPFPFEG
DEDADVINAGKQTITTLPGASFFDSATSFGMIRGQHVDLTILGAMEVAENGDIANWKIPG
KMVKGMGGAMDLVASAENIIVAMMHTNRAGDSKLLKKCSLPLTGVNCINKVVTNLAVLEV
TDDGFKLLERAPGVSVDDIKAATEGTLIVEGDIPEMSL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagtctagataaaacaggaattgcaaaaagaatcgctcaagaactacaagacggttac
tacgtcaatctagggattggaattcctaccctagttgcaaattatattcctgaaggtgtt
caggttgaatttcaatctgaaaatggtgtgttaggaatgggaccatttccttttgaagga
gatgaagatgctgatgtaattaatgcaggtaaacaaactattacaactttacctggagcc
agtttttttgatagcgcaacaagttttgggatgatacgtggacagcacgttgatttaacg
atactaggagctatggaagtagccgagaacggtgatatagcaaattggaaaattccaggt
aagatggtaaaaggaatgggtggtgccatggatctagttgctagtgccgaaaatattatt
gtagctatgatgcatacaaaccgtgctggtgatagtaaacttcttaaaaaatgttcatta
cctcttaccggtgtaaactgtattaataaagtggttaccaatcttgctgtgctcgaggtt
actgatgatggctttaaattactagaaagagctccaggcgtctctgtagacgatataaaa
gcagcaactgaaggtactcttatcgttgaaggtgatattcctgaaatgtccttataa

DBGET integrated database retrieval system