KEGG   Neorickettsia sennetsu: NSE_0048Help
Entry
NSE_0048          CDS       T00329                                 

Definition
(GenBank) putative succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nse  Neorickettsia sennetsu
Pathway
nse00020  Citrate cycle (TCA cycle)
nse00190  Oxidative phosphorylation
nse00650  Butanoate metabolism
nse01100  Metabolic pathways
nse01110  Biosynthesis of secondary metabolites
nse01120  Microbial metabolism in diverse environments
nse01130  Biosynthesis of antibiotics
nse01200  Carbon metabolism
Module
nse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nse_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nse00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NSE_0048
   00650 Butanoate metabolism
    NSE_0048
  Energy metabolism
   00190 Oxidative phosphorylation
    NSE_0048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABD45697
UniProt: Q2GEZ7
Position
38207..38536
Genome map
AA seq 109 aa AA seqDB search
MRCVVRSWLAQRITALLLFLLFIFLLFSLRSSKWIFPFDVEYLSCHWGVLLVFAMFVLIA
QCHALLGLNVIIEDYIASSILRKVLVSLNIIFVGSTLFAFVAVFYRLFF
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgagatgtgttgttaggagttggttagctcaacgcattacagctcttttgctgtttttg
ttatttatctttttacttttctcgcttcgttcttctaaatggattttcccatttgatgtc
gaatatctaagttgccattggggtgtccttttggtatttgctatgttcgtgttaattgct
cagtgccacgctttgctcggattaaatgtaataatagaggattacatcgcttcctctatt
ctacggaaggtccttgtttctttgaacattatctttgttggctctactctttttgcgttt
gtagctgtattttatagattatttttttag

DBGET integrated database retrieval system