KEGG   Neorickettsia sennetsu: NSE_0251Help
Entry
NSE_0251          CDS       T00329                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nse  Neorickettsia sennetsu
Pathway
nse00020  Citrate cycle (TCA cycle)
nse00640  Propanoate metabolism
nse01100  Metabolic pathways
nse01110  Biosynthesis of secondary metabolites
nse01120  Microbial metabolism in diverse environments
nse01130  Biosynthesis of antibiotics
nse01200  Carbon metabolism
Module
nse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nse00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NSE_0251 (sucC)
   00640 Propanoate metabolism
    NSE_0251 (sucC)
   00660 C5-Branched dibasic acid metabolism
    NSE_0251 (sucC)
Enzymes [BR:nse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NSE_0251 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABD46226
UniProt: Q2GEF1
Position
complement(213069..214247)
Genome map
AA seq 392 aa AA seqDB search
MNIHEYQAKEILRVCGVPTPAGFLVQEDTETSEIAKSLARLGGKVFAVKAQIHAGGRGKA
GGVVICRSVEEAIDNTKKMLGMNLVTHQTSPAGQKVRKVYIEAGQSILKEYYLSMVVDRE
NAKVAIIASEEGGMDIEEIARSTPEKIKKVFVDLSIGISDFHARKIGFELGLSLAQIKQF
TPLVKKLYALFVTRDASQVEINPLIANSKGEFIALDAKLNFDDNALYRHPDTLELRDLYE
EDPKEIEAAKYNLNYIKMEGGIGCMVNGAGLAMATMDIIKYYGASPANFLDVGGGANLEQ
VTNAFKIISSDKHVAGILVNIFGGIMRCDIIAEGIVAAAKDIGLTMPLVVRLSGTNYSAG
IKIIEGSGLNIVTASELDDAAQKIVKLTRKEI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgaataccaagcaaaggagatactgcgagtctgtggtgtgcccacgccc
gccgggtttttggttcaagaggatacagaaacctcagaaatcgcaaaaagtttagctcga
ctgggtggcaaggtatttgcagtgaaagctcaaatacatgcaggtggaagaggtaaagct
ggtggtgtcgtgatttgtcgttctgttgaagaggcgatagataacacaaaaaaaatgctt
ggtatgaacctggtaactcatcaaacttctccagcgggacagaaagtacggaaggtctat
attgaggctggacagtcgatcctgaaagaatactacctaagcatggtggttgatagagaa
aacgcgaaagtggccataattgcctcagaagaagggggaatggacatagaagaaattgcg
agatcgaccccagaaaaaatcaagaaagtctttgtagatctaagtattggtatatcagac
tttcacgcaaggaaaataggatttgagctaggactcagtcttgctcaaattaagcagttc
acaccacttgtgaagaaattgtatgctctattcgtcacaagggatgcctctcaagtcgaa
ataaaccccttgatagcaaatagtaaaggtgagttcatagcgttagatgcaaaacttaac
ttcgacgataatgcgctttatcgccacccagatacgctagaactaagagatttatacgaa
gaggacccaaaagaaattgaggcggcaaaatacaatctcaactacatcaaaatggaaggc
ggcataggttgtatggtaaacggagctgggctcgcgatggcaacaatggacatcataaaa
tattatggtgctagtccagcgaatttcctagatgttggtggtggggccaacctagagcaa
gtcacgaacgcatttaaaataatttcatctgacaaacatgtcgccggcatattagtgaac
attttcggtggtatcatgcgttgtgatatcatcgcggagggtatagttgcagcagccaaa
gatataggtcttactatgcctttagtcgtccgcctatccggcactaactactctgctgga
ataaagattattgagggctccggactgaatattgtgaccgcctccgaacttgatgatgcg
gcacaaaaaatcgtaaaactgacaaggaaggaaatttaa

DBGET integrated database retrieval system