KEGG   Neorickettsia sennetsu: NSE_0613Help
Entry
NSE_0613          CDS       T00329                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
nse  Neorickettsia sennetsu
Pathway
nse00780  Biotin metabolism
nse01100  Metabolic pathways
Module
nse_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:nse00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NSE_0613 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nse01007]
    NSE_0613 (bioF)
Enzymes [BR:nse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     NSE_0613 (bioF)
Amino acid related enzymes [BR:nse01007]
 Aminotransferase (transaminase)
  Class II
   NSE_0613 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase OKR_DC_1 DegT_DnrJ_EryC1 Aminotran_5 SHMT
Motif
Other DBs
NCBI-ProteinID: ABD46379
UniProt: Q2GDF3
Position
536418..537599
Genome map
AA seq 393 aa AA seqDB search
MEEASENTSCYADFLTQRSAKNLYRQLETCLNERSCINFSSNDYLGLSKSRETLEAAYSY
GLKSGIGATGSRLLSGNNTIFKELEQQIAKDKNTEAALVMGSGFQTNITVLSTLLDRSVL
GQRAIVFFDRLNHSSLYHAILLAGAEMVRYRHCDMEDLSRLMEKYSADRRPKFIVTETLF
GMDGDVQDMERIATLAHQHKAVLYLDEAHATGILGKSGYGLSTNFDLSGITHVIMGTFSK
AIGVFGSYIASSTLIKNYLINKCPGLIYSTALPPILLGAIAKAWETVALLSKERKTLLEM
ASKARKFLSQEGYNIGNSTNHIIPIILGEEEKVLTLKQKLLGKGIIVSAVRPPTVPVNTS
RIRIALCAFHTKHDIAHLLQNIKSTKNLTEDTA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcttcggaaaatacatcttgctatgcagattttctcacacaaagaagcgca
aagaatctctatcgtcaactcgagacgtgcctgaatgaaagaagttgcattaatttctcg
tcaaatgattaccttggcttaagtaaatctagggagacattagaagctgcctattcatat
ggtttaaagagcgggattggggcgactggatcgagacttctctcaggaaacaacacaatt
tttaaagaactcgaacaacaaatcgcaaaagacaaaaataccgaagctgccttagtaatg
ggttcgggttttcagacaaacataacggtactttccactcttcttgatagatctgtcctt
ggccaaagagcaattgtgttcttcgataggttgaatcactccagcctgtaccacgcaata
cttcttgctggtgcagaaatggtccgttatagacactgtgatatggaagatctttcccga
ttaatggaaaaatactctgcggatagacgtccaaaattcatagtaacggagacattattc
ggaatggatggcgatgtacaagacatggagcgtatagctactttagcacatcaacataag
gcagtgctgtatctggatgaagcacatgctacaggcattcttggaaagagtgggtatggt
ctctcaactaactttgacctttcagggatcacacatgtaatcatgggaacatttagcaag
gcaattggggtctttggaagctatatcgcatcttctacattgataaaaaattacctgatc
aacaaatgccctggtttgatatactcgaccgcactcccacctattctgctaggtgcaata
gcaaaagcatgggaaacggtagcgctcttaagcaaagaaagaaaaacactgctagaaatg
gcaagtaaagcaagaaaatttcttagccaggaagggtacaatatcggcaattcaaccaat
catataattcccatcatacttggagaggaagaaaaagttctcacattgaagcaaaaactt
ctcggaaaaggaataattgtctctgctgtgcgtccaccaactgtacctgtgaacacatca
agaattcgtatagcattgtgtgcatttcacactaaacacgacattgcccaccttctacaa
aacatcaaaagcaccaaaaacctaaccgaagacactgcatga

DBGET integrated database retrieval system