KEGG   Neisseria sicca: A6J88_01190Help
Entry
A6J88_01190       CDS       T04958                                 

Definition
(GenBank) bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase PutA
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
nsi  Neisseria sicca
Pathway
nsi00250  Alanine, aspartate and glutamate metabolism
nsi00330  Arginine and proline metabolism
nsi01100  Metabolic pathways
nsi01110  Biosynthesis of secondary metabolites
nsi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nsi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A6J88_01190
   00330 Arginine and proline metabolism
    A6J88_01190
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nsi03000]
    A6J88_01190
Enzymes [BR:nsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     A6J88_01190
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     A6J88_01190
Transcription factors [BR:nsi03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    A6J88_01190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: ARC50067
UniProt: A0A1V0HB76
Position
complement(244000..247605)
Genome map
AA seq 1201 aa AA seqDB search
MFDFAFPTQTPLRQAITDAYRRDEIEAVQDMLQRAQMSDEERRAASELARRLVTQVRASR
TKASGVDALMHEFSLSSEEGIALMCLAEALLRIPDNATRDRLIADKISEGNWKSHLNNSP
SLFVNAAAWGLLITGKLTAPSDKQMGSALNRLVSKGGAPLIRQGVNYAMRLLGKQFVTGQ
TIEEALQNGKEREKMGYRFSFDMLGEAAYTQEDADRYYNDYVQAIHAIGKDAAGQGVYEG
NGISVKLSAIHPRYSRAQHERVMSELLPRLKELFLLGKKYDIGINIDAEEANRLELSLDL
MEALVSDPDLAGYKGIGFVVQAYQKRCPFVIDYLIDLARRNNQKLMIRLVKGAYWDSEIK
WAQVDGLDGYPTYTRKVHTDISYLACARKLLDAQDAVFPQFATHNAYTLGAIYQMGKGKD
FEHQCLHGMGETLYDQVVGPQNLGRRVRVYAPVGTHETLLAYLVRRLLENGANSSFVNQI
VDENISIDTLIRSPFDTIAEQGIHLHNALPLPRDLYGRGRLNSQGVDFSNETVLQQLQEK
LNRAAAQDFHAASIINGKARDVGEAQPIKNPADHDDIVGTVSFADAALAQEAIGAAVAAF
PEWSATPAAERANCLRRFADLLEQHTPALMMLAVREAGKTLNNAVAEVREAVDFCRYYAN
EAENTLPKDAKAVGAIVAISPWNFPLAIFTGEVVSALAAGNTVIAKPAEQTSLIASYAVS
LMHEAGIPTSALQLVLGAGDVGAALTGDPRIGGVIFTGSTEVAQLINKALAKRDDSPVLI
AETGGQNAMIVDSTALPEQVCLDVLNSAFDSAGQRCSALRILCVQEDVADKMLAIIKGAM
DELVVGKPVQLTTDVGPVIDAEAQQNLQSHINKMKGVAKSYHEVKAASDVDPAKSTFVLP
ILFELNNLNELTREVFGPVLHVVRYRADELDQIIDQINSKGYALTSGVHSRIEGTVKRIR
ERIEAGNVYVNRNIVGAVVGVQPFGGHGMSGTGPKAGGSFYLQKLTRIPEWVAPPLSRIG
QADEAALKRLEALIHKLPFNAEEKKAAASALGHARIRTLRQAESVLVGPTGERNAMSWRA
PKRVWVHGGSLLQAFCALTELAAAGIVTVVEPDSPLASYTADLEGLLQVNSKPENTGVHH
VAALSPLDSSRKQELAKRDGALIRILPSEQGLDILQVFEEISCSVNTTAAGGNASLMAVS
D
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactttgcttttccgacacaaacgccactgcgccaagcgattaccgatgcttac
cgccgcgacgaaatcgaagccgttcaggatatgctgcaacgcgcccagatgagcgacgag
gagcgtcgggcggcgtccgaactcgcgcgccgtttggttacgcaggttcgtgccagccgc
accaaagccagcggggtggatgcgctgatgcacgagttttcgctctccagcgaagaaggc
attgcgctgatgtgtctggcggaggctttgctgcgcattcccgacaatgcgacgcgcgac
cgcctgattgccgacaaaatttccgaaggcaactggaaaagccatttgaacaacagcccg
tccctgttcgtcaacgccgccgcatggggcttgctgattaccggcaaactgaccgcgccg
agcgacaagcagatgggttcggctctgaaccgcctcgtcagcaaaggcggcgcccccctg
atccgccaaggcgtgaactacgccatgcgcctgttgggcaagcagtttgttaccggacaa
accattgaagaagcgctgcaaaacggcaaagagcgcgaaaaaatgggctaccgcttctcc
ttcgatatgttgggcgaagccgcctacacccaagaagatgccgaccgctattacaacgac
tacgttcaagccattcacgccatcggcaaagatgccgccggacaaggcgtttatgaaggc
aacggcatttccgtcaaactttccgccatccatccgcgctactcgcgcgcccaacacgaa
cgcgtgatgagcgaactcctacctcgtctgaaagagctgttccttttgggtaaaaaatac
gatatcggtatcaacatcgacgccgaagaagccaaccgtttggagctgtctttggatttg
atggaggcactcgtttccgaccccgatttggcgggttacaaaggcatcggctttgtcgtt
caggcatatcaaaaacgctgccccttcgtcatcgactatctgattgaccttgcccgccgc
aacaatcaaaaactgatgatccgcctcgttaaaggcgcgtactgggacagcgaaatcaaa
tgggcgcaagtggacggcctggacggctatccgacctacacccgcaaagtccataccgac
atttcctacctcgcctgcgcgcgcaaactgctggacgctcaagacgccgtgttcccgcaa
ttcgccacccacaacgcctacaccttgggcgcgatttaccaaatgggcaaaggcaaagac
tttgaacaccaatgcctgcacggcatgggcgaaaccttgtacgatcaagtggtcggtccg
caaaacttaggccgccgcgtgcgcgtgtacgccccggtcggtacgcacgaaaccctgctt
gcctacttggtgcgccgcctgttggaaaacggcgcgaactcgtcgttcgtcaaccaaatc
gtcgatgaaaacatcagcatcgacacgctgatccgaagcccgtttgacaccatcgccgaa
caaggcatccatctgcataatgccttgccgctgccgcgcgatttgtacggcaggggtcgt
ctgaattctcaaggcgtcgatttcagcaacgaaaccgtgttgcaacagcttcaagaaaaa
ctcaaccgcgccgccgcgcaagacttccatgccgcatccattatcaacggcaaagcccgc
gatgtcggcgaagcgcaaccgattaaaaaccccgccgaccacgacgacatcgtcggcaca
gtcagctttgccgatgccgcgcttgcccaagaagcgattggcgcagccgttgccgcgttt
cctgaatggagcgcgacgccagccgccgagcgcgctaattgcttgcgccgtttcgccgat
ttgctggagcagcacacccccgcgctaatgatgcttgccgtgcgcgaagcaggtaaaacg
ctgaacaacgccgtcgccgaagtgcgcgaagccgtcgatttctgccgctactacgcaaac
gaagctgaaaacaccctgcccaaagatgccaaagccgtcggcgccatcgtcgccatcagc
ccgtggaacttcccgctcgccatctttaccggcgaagtcgtttccgcattggcagccggt
aacaccgttatcgccaaacctgccgaacaaaccagcctgattgccagctacgccgtttcc
ctgatgcacgaagcaggcatcccgacttccgccttgcaacttgtcctcggcgcaggcgat
gtcggtgcggcactgacaggcgacccgcgtatcggcggcgtgattttcaccggctcgacc
gaagtggcgcaactgattaacaaagccctcgccaaacgcgacgacagccccgtattgatt
gccgaaaccggcggtcaaaacgccatgattgtcgattctaccgcgctgcccgagcaagtt
tgcttggacgtgctcaactccgcctttgacagcgcgggacaacgctgctccgccctgcgt
atcctttgcgtccaagaggacgttgctgacaagatgctcgccatcatcaaaggcgcgatg
gacgaattggtcgtcggcaaacccgttcaacttaccaccgacgtaggccccgtcatcgat
gccgaagcgcagcaaaacctgcaatcgcacatcaataaaatgaaaggcgttgccaagtct
taccacgaagtcaaagccgcctccgacgttgatcctgcgaaatccactttcgtgctgccg
attttgttcgaactcaacaacttgaacgaactcacccgcgaagtcttcggtcccgtcctg
cacgttgtccgctaccgtgccgacgaacttgaccaaatcatcgaccaaatcaacagcaaa
ggctacgcgctcaccagcggcgtacacagccgtatcgaaggtacggtcaaacgcatccgc
gaacgcatcgaagcgggtaacgtttacgtcaaccgcaacatcgtcggcgccgtcgtcggc
gtacaaccgttcggaggacacggtatgtccggtactggtccgaaagcgggcggctcgttc
tacctgcaaaaactgacccgtatccccgaatgggttgccccgccgctgagccgcatcgga
caagcggacgaagccgcgctcaaacgcctcgaagccttgattcacaagctgccgtttaat
gcggaagagaaaaaagcagcggcatcagcattgggacacgcccgcatccgcaccctgcgc
caagcagaatccgtcttggtcggcccgaccggcgaacgcaacgccatgagctggcgcgcg
cccaaacgcgtctgggtacacggcggcagtctcctgcaagccttctgcgccctgaccgaa
cttgccgccgcaggcatcgtaaccgtcgtcgaacccgacagcccgcttgcctcctacacc
gccgacctcgaaggcctgctgcaagtcaacagcaaacctgaaaacacaggcgtgcaccac
gtcgccgccctaagcccgctggacagcagccgcaagcaagagctggcaaaacgcgacggc
gcactcatcagaatcctcccgtccgaacaaggcttggacatcctgcaagtgtttgaagaa
atctcttgcagcgtcaacaccacagccgccggcggcaacgccagcctgatggccgtttcc
gactaa

DBGET integrated database retrieval system