KEGG   Neisseria mucosa FDAARGOS_260: A6J88_02455Help
Entry
A6J88_02455       CDS       T04958                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nsi  Neisseria mucosa FDAARGOS_260
Pathway
nsi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nsi01100  Metabolic pathways
nsi01110  Biosynthesis of secondary metabolites
nsi01130  Biosynthesis of antibiotics
nsi01230  Biosynthesis of amino acids
Module
nsi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nsi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A6J88_02455
Enzymes [BR:nsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     A6J88_02455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PIG-X
Motif
Other DBs
NCBI-ProteinID: ARC50277
UniProt: A0A1V0HBT0
Position
complement(487495..488277)
Genome map
AA seq 260 aa AA seqDB search
MTDILNKILATKALEVATQKASVSLDEMKKQADAALPVRGFFDSIRTKHEQNRPAVIAEI
KKASPSKGLIRPDFHPAQIARAYENAGAACLSVLTDEQYFQGSPEYLKAARAAVGLPVLR
KDFIIDEYQIYQARAWGADAVLLIAAALEQEQLEHFEAVAHQLGMSVLLELHDASELEKC
RNLATPLWGVNNRNLRTFDVSLQQTLDLLPALAGKTVVTESGIRDKADVDFMRSHGVHTF
LIGETFMRADDIEAEVRKLF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattctgaataaaatccttgcaaccaaagccctggaagtcgccacacaaaaa
gcttctgtctctttggatgaaatgaaaaaacaggcagatgccgccttgcccgtacgcggt
ttttttgactctatccgtaccaaacacgagcaaaaccgccctgccgtcattgctgaaatt
aaaaaagccagcccgagcaaagggctgatcagacccgatttccatcctgcacagattgcc
cgtgcctatgaaaatgccggagctgcgtgcttgtcggtattgactgacgaacaatatttc
caaggctctcccgaatatttgaaagcggcacgtgcggcagtcgggcttcccgttctacga
aaagacttcatcatcgatgagtatcagatttatcaggcgcgtgcctggggggctgatgcc
gtcttactgattgccgccgcgctggagcaagaacaattagagcatttcgaagcagtagcc
catcaattaggcatgagcgtattgttggaactgcatgatgcttccgaattggaaaaatgc
cgaaatctggcgacacccctatggggtgtaaacaaccgcaacctgcggacattcgacgta
tctttacagcagactctggatttactgcctgcgctggcaggtaaaaccgtcgttaccgaa
agcggcatccgcgacaaggcggacgtggatttcatgcgcagccacggcgtgcataccttc
cttatcggcgagacctttatgcgtgccgacgatattgaagcagaagtgcggaagttgttt
taa

DBGET integrated database retrieval system