KEGG   Neisseria sicca: A6J88_02940Help
Entry
A6J88_02940       CDS       T04958                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
nsi  Neisseria sicca
Brite
KEGG Orthology (KO) [BR:nsi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nsi03016]
    A6J88_02940
Enzymes [BR:nsi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     A6J88_02940
Transfer RNA biogenesis [BR:nsi03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    A6J88_02940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 YjbR Plasmid_stab_B
Motif
Other DBs
NCBI-ProteinID: ARC52158
UniProt: A0A1V0HH17
Position
complement(575823..576530)
Genome map
AA seq 235 aa AA seqDB search
MLDILYRDSRTIAVNKPAGMLVHRSWLDRHETQFVMQTLRDQIGQHVYPAHRLDRPTSGV
LLFALDPEAARLLTQQFEQKTTHKTYWAIVRGYLPDDGLIDYPLKYQPDKIAESQTEATL
QEAQTRYRCLARTELPFQSAARYPTSRYSWAELIPHTGRKHQLRRHMKHIFHPIVGDTNY
GDLRQNHATAAHLGPTRLMLHARSLSFQSIENGETLTVCADTDESWRIWLNTFEA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacatcctctaccgcgacagccgcaccatcgccgtcaacaaacccgccggaatg
ctcgtccaccgaagctggctcgaccgccacgaaacacagttcgtcatgcagaccctgcgc
gaccaaatcggacaacacgtctatcccgcccaccgcctcgaccgccccacatccggcgtc
ctcctgtttgccctcgaccccgaagccgcccgcctgctgacgcagcagttcgaacaaaaa
accacacacaaaacctactgggcaatcgtgcgcggatatttgcccgacgacggactcatc
gactaccccctcaaatatcagcccgacaaaatcgccgaatcccaaaccgaagccaccctc
caagaagcccaaacccgataccgctgccttgcgcgcaccgaattgcccttccaatccgcc
gcccgctacccgacctcgcgctactcgtgggcagaactcatcccgcacacaggccgtaaa
caccaactccgccgccacatgaaacacatcttccaccccatcgtcggcgacaccaactac
ggcgacctgcgccaaaaccacgccaccgccgcccacctcggccccacccgcctcatgctc
cacgcccgcagcctgtcgttccaaagcatcgaaaacggcgaaaccctgaccgtctgcgcc
gataccgacgagagctggcggatttggctgaatacgtttgaggcgtaa

DBGET integrated database retrieval system