KEGG   Neisseria mucosa FDAARGOS_260: A6J88_07135Help
Entry
A6J88_07135       CDS       T04958                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
nsi  Neisseria mucosa FDAARGOS_260
Pathway
nsi00430  Taurine and hypotaurine metabolism
nsi00620  Pyruvate metabolism
nsi00640  Propanoate metabolism
nsi00680  Methane metabolism
nsi01100  Metabolic pathways
nsi01120  Microbial metabolism in diverse environments
nsi01200  Carbon metabolism
Module
nsi_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:nsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A6J88_07135
   00640 Propanoate metabolism
    A6J88_07135
  09102 Energy metabolism
   00680 Methane metabolism
    A6J88_07135
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    A6J88_07135
Enzymes [BR:nsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     A6J88_07135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ARC51024
Position
1415277..1416473
Genome map
AA seq 398 aa AA seqDB search
MTQKLILVLNCGSSSLKGAVLDNDSGEVLLSCLAEKLNLPDAYITFKVNGEKHKVDLSAK
PDHTGAVEALMEELKAHGLDSRIGAIGHRVVSGGELYSESILVDDEVIAGIEKCIPLAPL
HNPAHLLGLRAAQSIFKGLPNVVVFDTAFHQTMPEHAYTYAIPHELYEKYGLRRYGAHGT
SYRFVSDETARFLGKDKKDLRMVIAHLGNGASITAVANGESRDTSMGLTPLEGLVMGTRS
GDIDPAVFGFLAENANMTITQITDMLNKKSGLLGLSGLSNDCRTIEEESGKGHPGAKLAL
DVFIYRLAKYIGSMAVAAGGLDVLVFTGGIGENSDIIRERVLGYLGFLGLKADHEANLKA
RFGNAGVITTADSAAVAVVIPTNEELMIAHDTARLSGL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaaactcatcttagttttgaactgcggcagctcatccctcaaaggcgccgtg
ctggataacgacagcggagaagtcctgctcagctgccttgccgaaaaactcaacctgccc
gacgcttacatcacgttcaaagtaaacggcgaaaaacacaaagtcgacctgtccgccaag
cccgaccacaccggcgcagttgaagccctgatggaggaactcaaagcccacggcctcgac
agccgcatcggcgccatcggccaccgcgttgtcagcggcggcgaactgtacagcgaatcc
atccttgttgacgacgaagtcatcgccggcatcgaaaaatgtatcccgctcgcccccctg
cacaaccccgcgcacctcttgggcctgcgtgccgcacaaagcattttcaaaggcctgccc
aacgttgtcgtgttcgacaccgctttccaccaaaccatgccggaacacgcctacacatac
gcgattccgcatgaactgtatgaaaaatacggcttgcgccgctacggcgcgcacggtacc
agctaccgcttcgtttctgatgaaaccgcccgtttcctcggcaaagacaaaaaagacctg
cgcatggtgattgcccacttgggtaacggcgcgtccattaccgccgtcgccaacggcgaa
tcacgcgataccagcatgggcctgactccgctggaaggcctcgtgatgggtacgcgcagc
ggcgacatcgatcccgcagtcttcggctttctcgctgaaaacgccaacatgaccatcacc
caaatcaccgacatgttgaacaaaaaatccggcctgctcggcttgtccggcctgtccaat
gactgccgtaccatcgaagaagaatccggcaaaggccatcccggcgcgaaactcgccctg
gacgtcttcatctaccgcctcgccaaatacatcggtagcatggctgtggcagccggcggt
ctggacgtactcgttttcaccggcggtatcggcgaaaactccgacatcatccgcgagcgc
gtactcggctacttgggcttcctcggtctgaaagccgaccatgaagccaacctgaaagcc
cgcttcggtaacgccggcgtgattacgactgccgacagcgcagccgtcgccgttgttatc
ccgaccaacgaagaattgatgattgcacacgataccgcccgtctgagcggcctgtaa

DBGET integrated database retrieval system