KEGG   Nocardia sp. Y48: BOX37_04625Help
Entry
BOX37_04625       CDS       T04582                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
nsl  Nocardia sp. Y48
Pathway
nsl00360  Phenylalanine metabolism
nsl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nsl00790  Folate biosynthesis
nsl01100  Metabolic pathways
nsl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nsl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BOX37_04625
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BOX37_04625
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BOX37_04625
Enzymes [BR:nsl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BOX37_04625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: APE33370
UniProt: A0A1J0VMY1
Position
complement(1030856..1031752)
Genome map
AA seq 298 aa AA seqDB search
MFTEAQLYSPVTRERDGDVTVHLSDDHPGVHDENYRARRNAIAALALDYTPGAPAPHIDY
TDDEERVWRIASAELARKHQTYACREVREAAAELALPRDHIPQLDEVSALLAPLTGFTYV
PAAGLVGLREFFGSFAERTFHSTQYIRHHSAPLYTPEPDAIHEIIGHANQIASPRFAALY
ATVGAAVARLTTDTALKFLADVFWFSLEFGVVREDDEIRCYGAGLLSSYGEIDEFRHARL
RPLDVAAMGTITYDITRYQPVLFCADSVDQLVDVLGEFFATMDDETPDRFARDSVTRP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccgaggcacagttgtattcgccggtgacgcgcgagcgtgacggcgatgtcacc
gttcacctgagcgatgatcatcccggcgtgcacgacgagaactatcgagcccgccgcaac
gccatcgccgcgctggcactcgactacacacccggcgcacccgctccgcacatcgactac
accgacgacgaagagcgggtgtggcggatcgcctcggccgaactggcccgcaagcaccag
acctacgcctgtcgcgaggtacgcgaggcggccgccgaactcgccctgccgcgcgatcac
atcccgcaactcgacgaggtgtcggcgctgctcgccccgctcaccgggttcacctacgtg
ccggccgccggactcgtcgggctccgcgagttcttcggttccttcgccgagcgcaccttc
cactccacccagtacatccgccaccactccgccccgctctacacccccgagcccgacgcg
atccacgagatcatcggccacgcgaaccagatcgcgagcccgcgcttcgccgcgctctac
gcgacggtcggcgccgcggtggcccgattgaccaccgataccgcgctgaaattcctggcc
gacgtgttctggttctccctcgaattcggtgtggtccgtgaggacgacgagatccgttgc
tatggcgccggattgctctcctcctacggcgagatcgatgaattccggcacgcccggcta
cgcccgctcgatgttgccgcgatgggcacgatcacctacgacatcacccgctaccagccc
gtgttgttctgcgcggattcggtggatcagctcgtcgacgtgctcggcgaattcttcgcg
accatggatgacgagacaccggaccggtttgccagggattcggtgacgcgtccgtaa

DBGET integrated database retrieval system