KEGG   Nocardia sp. Y48: BOX37_08985Help
Entry
BOX37_08985       CDS       T04582                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
nsl  Nocardia sp. Y48
Pathway
nsl00670  One carbon pool by folate
nsl01100  Metabolic pathways
nsl01120  Microbial metabolism in diverse environments
nsl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nsl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BOX37_08985
Enzymes [BR:nsl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     BOX37_08985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: APE34080
UniProt: A0A1J0VPV5
Position
2005866..2006867
Genome map
AA seq 333 aa AA seqDB search
MDFDNGRGRSTPDRPASARQIVSRTPSVVQSLRTHSGSGVPFSVEFNPPRDAAGEARLWR
AVRQFERMHPAFVSMTYGAGGSTSDRTVRITGELATETTLLPVAHLTAVGHSIAELRSLV
GSYADSGIRNLLVLRGDPPGDPLGEWHKHPSGVEYAEELVRIVRDLGDFHVGVASFPQGH
HRSPDLDHDTLHLAAKLRAGAEYSITQMFFDVEHYLRLRDRVVAMDPIEGAKPIIPELMP
ITSLRTVQRAEELCGRTLPKSVMTRLEKAAGTAPEEDRAAVRAEGIQIATEMAQRLIDEG
APCLHFITLNFAKATSEVLTNLGYGVTAAPISA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtggatttcgacaacggacggggacgctcgacccctgatcgccccgcctcggcccggcag
atcgtctcgcgcaccccgtcggtggtgcagagtctgcgcacccattccggcagtggcgtg
ccgttctcggtcgaattcaatccgccccgcgacgcggccggcgaggccagattgtggcgc
gcggtgcgccagttcgaacggatgcatcccgccttcgtctcgatgacctacggtgcgggc
ggatccaccagcgaccgcaccgtccggatcaccggcgaactcgccaccgagaccaccttg
ctcccggtcgcccacctcaccgcggtcggccacagcatcgccgaactgcgttccctggtc
ggctcctacgccgactccgggatccgtaacctgctggtcctgcgcggcgacccgccgggc
gaccccctcggcgagtggcacaagcaccccagcggcgtcgaatacgccgaggaactggtc
cgcatcgtccgcgacctcggcgatttccacgtcggcgtggcctcgttcccccagggccac
caccgctcacccgacctcgaccacgacaccctccacctcgccgcgaaactgcgtgcgggc
gcggagtattcgatcacccagatgttcttcgacgtcgagcactacctgcgcctgcgggat
cgcgtcgtcgccatggacccgatcgagggcgccaagccgatcatccccgaactcatgccc
atcacctccctgcgcaccgtccagcgcgccgaggaactctgcgggcgcaccctgccgaaa
tcggtgatgacccggctggagaaggccgcgggcaccgccccggaagaagaccgcgcggca
gtccgtgccgaaggcatccagatcgccaccgagatggcccagcgcctcatcgacgagggc
gctccctgcctgcacttcatcaccctcaacttcgccaaggccaccagcgaagtcctcacc
aacctcggttacggcgtcaccgccgcccccatcagcgcgtaa

DBGET integrated database retrieval system