KEGG   Nocardia sp. Y48: BOX37_21920Help
Entry
BOX37_21920       CDS       T04582                                 

Definition
(GenBank) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
nsl  Nocardia sp. Y48
Pathway
nsl00860  Porphyrin and chlorophyll metabolism
nsl00970  Aminoacyl-tRNA biosynthesis
nsl01100  Metabolic pathways
nsl01110  Biosynthesis of secondary metabolites
nsl01120  Microbial metabolism in diverse environments
Module
nsl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nsl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BOX37_21920
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BOX37_21920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nsl01007]
    BOX37_21920
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nsl03016]
    BOX37_21920
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:nsl02048]
    BOX37_21920
Enzymes [BR:nsl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     BOX37_21920
Amino acid related enzymes [BR:nsl01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BOX37_21920
Transfer RNA biogenesis [BR:nsl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BOX37_21920
 Prokaryotic type
   Other AARSs
    BOX37_21920
Prokaryotic defense system [BR:nsl02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BOX37_21920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: APE36142
UniProt: A0A1J0VVT8
Position
complement(4886237..4887712)
Genome map
AA seq 491 aa AA seqDB search
MTEVRVRFCPSPTGTPHVGLIRTALFNWAYARHHGGSFVFRIEDTDAARDSEDSYRALLD
ALRWLGLTWDEGPEVGGPYEPYRQSLRRDQHLDVVAKLLAAGEAYEAFSTPEEVEDRHRA
AGRDPKLGYDNFDRDLSDEQIAAYKAEGRPAVVRLRMPDEDLGWNDLVRGETIFKAGTVP
DFALTRGNGDPLYTLVNPVDDALMRITHVLRGEDLLSSTPRQLALYAALQRIGVAEFTPE
FGHLPFVMGQGNKKLSKRDPESNLFLHRDRGFVPEGLLNYLALLGWSIAEDRDVFSMAEM
VAAFDVSTVNSNPARFDQKKADAINAEQIRLLEPGDFGHRLREYLTAHGHIGADIDEKTF
LAAADLVQTRIVVLGDAWGLLKFLFVAPEDFAIDPAAGAKNLGAEADQVLDAAIAAVEPL
SAWTTPALEEALKTALIDDLGLKPRKAFAPVRVAVTGSHISPPLYESMELLGREVSLDRL
RAARGWVPAAE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtacgggtccgtttctgcccgtcgccgaccggcacgccgcacgtcggcctg
atccgcacggcgctgttcaactgggcctacgcgcgccaccacggcggtagtttcgtgttc
cgcatcgaggacaccgacgccgcacgcgattccgaggattcctaccgcgcgctgctggac
gcgctgcgctggctcggtctcacctgggacgagggccccgaggtcggcggtccttacgag
ccgtaccggcagtcgctgcgccgcgaccagcacctcgatgtcgtggcgaagttgctcgcg
gccggtgaggcctatgaggcattctccacaccggaggaagtcgaggatcgccacagggct
gctgggcgtgatccgaaactcggctacgacaatttcgatcgtgacctgagcgacgagcag
atcgcggcgtacaaagccgagggacggccggccgtggtgcgcctgcggatgcccgatgaa
gatctcggctggaatgatctcgtgcgcggggaaaccatcttcaaggccggtaccgtcccc
gatttcgcgctcacccgtggaaatggcgacccgctctacacactggtgaatccggtggac
gacgcgttgatgcggatcacccatgtgttgcgtggcgaggacctgctctcctcgactccg
cgtcagctcgcgttgtacgcggcgctgcagcgtatcggggtcgccgagttcacacccgag
ttcgggcacctgccgttcgtgatgggtcagggcaacaagaagctgtccaagcgcgatccg
gaatcgaatttgttcctgcatcgcgatcgtggattcgtccccgagggcttgctgaattac
ctcgccctgctcggctggagtatcgccgaggatcgcgatgtgttctccatggcggagatg
gtggctgcattcgatgtctcgacggtgaattcgaatcccgcgcgattcgaccagaagaag
gccgatgccatcaatgccgagcagattcgtttgctggaaccgggtgatttcggccaccga
ttgcgcgagtacctcaccgcgcacgggcacatcggcgccgatatcgacgagaagaccttc
ctggccgccgccgacctggtgcagacccgcatcgtggtgctcggtgacgcgtggggcctg
ctgaagttccttttcgtcgcgcccgaggacttcgcgatcgacccggcggcgggggccaag
aacctcggtgccgaggccgaccaggtgctcgacgccgcgatcgccgcggtggagccgctg
agcgcgtggaccaccccggcgctggaagaggcgctcaagaccgcgctgatcgacgatctc
gggctcaagccgcgcaaggccttcgcgccggtgcgggtggcggtgacgggttcgcacatc
agcccgccgctgtacgagtcgatggaactgctgggccgtgaggtctccctcgaccggctg
cgtgccgctcgcgggtgggtacccgctgcggagtag

DBGET integrated database retrieval system