KEGG   Nocardia mangyaensis: BOX37_25210Help
Entry
BOX37_25210       CDS       T04582                                 

Definition
(GenBank) methyltransferase type 11
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
nsl  Nocardia mangyaensis
Brite
KEGG Orthology (KO) [BR:nsl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:nsl03009]
    BOX37_25210
Enzymes [BR:nsl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     BOX37_25210
Ribosome biogenesis [BR:nsl03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BOX37_25210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 PCMT Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: APE36676
UniProt: A0A1J0VX96
Position
5640142..5640978
Genome map
AA seq 278 aa AA seqDB search
MSEVAALLACPECGHDLHTHEHVLRCDRGHSFDIARQGYVGLLTGASTKMTGDTADMLDA
RAAFQGTGHFAPIAGAAARACTEGAQTEGNAVLEVGAGTGYYLAETLDAAPDALGIALDV
SKPAARRAARAHPRMASILADAWLGLPLRDSTLTGVLSVFAPRNPAEIARVLAPGGRFVV
VTPTTGHLGELVGPLDMVRVDPDKDRRLADSLAGTFTRAEHTHVEFPMKLSRADVTHVIA
MGPSAFHGAPADDPRIASLPDSTEVTASVTVSTYLLNS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ctgtccgaggtggccgcactcctggcctgtccggagtgcggccacgacctgcacacgcac
gagcacgtgttgcgctgcgaccgcggacacagcttcgacatcgcccggcaaggttatgtc
ggactgctgaccggtgcgtcgacgaagatgaccggcgacaccgccgacatgctcgacgcc
cgcgcggccttccagggcaccgggcacttcgcgcccatcgccggggcagcggcacgcgcc
tgcaccgagggcgcacagactgaaggcaacgcggtcctcgaggtcggtgcgggcaccggc
tactacctggccgagaccctcgacgccgcacccgatgctctcggcatcgcgctcgatgta
tcgaaaccggccgcccgtagagccgcccgcgcacatccccgcatggcctcgatcctcgct
gacgcctggctcggcctcccgcttcgcgacagcaccctcaccggggtgctctcggtcttc
gccccacgcaaccccgccgagatcgcccgcgtcctcgcaccgggcggccggttcgtcgtg
gtcacccccaccaccgggcacctgggcgagctggtcggcccgctcgacatggtccgcgtc
gaccccgacaaggaccgtcgcctcgcggactcgctggccggcaccttcacccgagccgag
cacacccacgtcgagtttccgatgaaactctcccgtgccgatgtcacccacgtgatcgcg
atgggcccgtcggccttccatggcgcccccgccgacgacccgcgcatcgcgtcgttgccg
gacagcaccgaggtcaccgcctcggtcacggtgtcgacctatctgctcaactcgtga

DBGET integrated database retrieval system