KEGG   Nocardia soli: BOX37_25230Help
Entry
BOX37_25230       CDS       T04582                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nsl  Nocardia soli
Pathway
nsl00071  Fatty acid degradation
nsl00072  Synthesis and degradation of ketone bodies
nsl00280  Valine, leucine and isoleucine degradation
nsl00310  Lysine degradation
nsl00362  Benzoate degradation
nsl00380  Tryptophan metabolism
nsl00620  Pyruvate metabolism
nsl00630  Glyoxylate and dicarboxylate metabolism
nsl00640  Propanoate metabolism
nsl00650  Butanoate metabolism
nsl00900  Terpenoid backbone biosynthesis
nsl01100  Metabolic pathways
nsl01110  Biosynthesis of secondary metabolites
nsl01120  Microbial metabolism in diverse environments
nsl01130  Biosynthesis of antibiotics
nsl01200  Carbon metabolism
nsl01212  Fatty acid metabolism
nsl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nsl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BOX37_25230
   00630 Glyoxylate and dicarboxylate metabolism
    BOX37_25230
   00640 Propanoate metabolism
    BOX37_25230
   00650 Butanoate metabolism
    BOX37_25230
  Lipid metabolism
   00071 Fatty acid degradation
    BOX37_25230
   00072 Synthesis and degradation of ketone bodies
    BOX37_25230
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BOX37_25230
   00310 Lysine degradation
    BOX37_25230
   00380 Tryptophan metabolism
    BOX37_25230
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BOX37_25230
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BOX37_25230
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BOX37_25230
Enzymes [BR:nsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BOX37_25230
Exosome [BR:nsl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BOX37_25230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: APE36679
UniProt: A0A1J0VXM2
Position
complement(5643612..5644793)
Genome map
AA seq 393 aa AA seqDB search
MTTSVIVSGARTPVGRLLGGLKGFKASDLAGVAIKAALEKSGVAPEQVDYVILGQVLQAG
AGQLPARQAAIAGGIPLDVPSVLINKVCLSGINAIALADQLIRAGEHEIIVAGGMESMSQ
TPHLLPKSREGFKYGDTTLVDHMAYDGLHDVITDQAMGLLTEDRNDLDKVSREEQDALAA
ASHQRAAAAWKNGVFDDEVVPVAVPQRKGDPIYVTEDEGIRPETTVESLGKLRPAFRKDG
TVTAGTASQISDGAAAVIVMSKAKAQELGLEWIAEIGAAGQVAGPDSTLQDQPANAILAA
CAKEGITPAELDLIEINEAFAAVGVSSTKKLGYDPEKVNVNGGAISIGHPLGMSGARILL
HLALELKRRGGGVGAAALCGGGGQGDALIIRVP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacttctgtcatcgtgtccggtgcgcgtaccccggtcggcaggctgctgggcggc
ctcaagggcttcaaggcctcggatctggccggtgtggctatcaaggcggcgctcgagaag
agcggtgtcgcgcccgagcaggtcgactacgtgatcctcggccaggtgctgcaggccggt
gctgggcagctgcccgcccgccaggccgcgatcgccggcggtattccgctggacgtgccc
tcggtactgatcaacaaggtctgcctgtccggcatcaacgcgatcgcgctggccgaccag
ctgatccgcgccggtgagcacgagatcatcgtggccgggggcatggagtcgatgagccag
accccgcacctgctgcccaagagtcgtgagggcttcaagtacggcgacaccaccctggtc
gaccacatggcctacgacggactgcacgacgtgatcaccgaccaggcgatgggtctgctc
accgaggatcgcaacgatctggacaaggtgagccgcgaagagcaggacgcgctggccgcg
gcctcgcaccagcgtgccgccgccgcgtggaagaacggcgtcttcgacgacgaggtcgtg
ccggtcgcggtgccgcagcgcaagggtgacccgatctacgtcaccgaggacgaaggcatc
cgccctgagaccaccgtcgagtcgctgggcaagctgcgtccggccttccgcaaggacggc
accgtgaccgcgggcaccgcttcgcagatctccgacggcgcggccgcggtgatcgtgatg
agcaaggccaaggcgcaggagctggggctggagtggatcgccgagatcggcgcggccggt
caggtcgccggtccggactcgaccctgcaggaccagccggccaacgccattctcgccgcc
tgcgcgaaggagggcatcacgcccgccgagctggatctgatcgagatcaacgaggcgttc
gcggccgtgggggtgtcctcgaccaagaagctgggctacgacccggagaaggtcaacgtc
aacggtggggcgatctccatcgggcacccgctcggcatgtccggtgcgcggatcctgctg
cacctggcgctggagctgaagcggcgcggtggtggcgtgggtgccgcggcgctgtgtggt
ggtggcggccaaggtgacgccttgatcattcgagtgccctag

DBGET integrated database retrieval system