KEGG   Niabella soli: NIASO_16340Help
Entry
NIASO_16340       CDS       T03682                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
nso  Niabella soli
Pathway
nso00790  Folate biosynthesis
nso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nso00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NIASO_16340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nso04147]
    NIASO_16340
Enzymes [BR:nso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     NIASO_16340
Exosome [BR:nso04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NIASO_16340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AHF16291
UniProt: W0F4P1
Position
complement(3600296..3600526)
Genome map
AA seq 76 aa AA seqDB search
MWEEKDNTLYRKFEFSNFNEAFGFMTRVALVAEKMDHHPTWTNTYNKVEFWLSTHDAGDI
VTEKDRKLAKKIDSCL
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaagaaaaagacaatacattataccgcaagtttgaatttagtaacttcaatgag
gcttttggctttatgacccgggtggcactggttgccgaaaaaatggaccaccaccctacc
tggacgaacacctataacaaagtggagttctggctctctacacatgacgccggggatatt
gttacagaaaaggataggaaactggcaaaaaagatcgatagttgcctgtaa

DBGET integrated database retrieval system