KEGG   Nodularia spumigena: BMF81_01254Help
Entry
BMF81_01254       CDS       T05403                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
nsp  Nodularia spumigena
Pathway
nsp00520  Amino sugar and nucleotide sugar metabolism
nsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BMF81_01254
Enzymes [BR:nsp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     BMF81_01254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind adh_short
Motif
Other DBs
NCBI-ProteinID: AVZ30069
UniProt: A0A2S0Q6K4
Position
complement(1501148..1502083)
Genome map
AA seq 311 aa AA seqDB search
MRILVTGGAGFIGSHLIDRLIPAGHEVICLDNFYTGHKRNILKWMNNPNFELIRHDITEP
IRLEVDQIYHLACPASPVHYQYNPVKTVKTNVMGTMNMLGLAKRVKARFFLASTSEVYGD
PEVHPQPEEYRGSVNPIGIRSCYDEGKRIAETLAFDYYRQNKVEIRVARIFNTYGPRMLE
NDGRVVSNFIVQALQGNPLTVYGDGSQTRSFCYVSDLVEGFIRLMNGDYVGPVNLGNPGE
YTILELAQAVQNMVNPDAKIKYESLPSDDPRRRQPDITKAKTLLNWEPTIGLQEGLKLTV
EDFRKRMTSDT
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagaattttggtaacgggcggtgctgggttcattggttcccatctgattgacagatta
ataccagcaggacatgaggtaatttgcttagataacttttacacaggtcataaacgcaat
atcctcaaatggatgaataatcccaactttgaactcatccgccatgacatcacagaacca
attcgcttagaagtagatcaaatttatcatctagcctgtccagcttctcctgtacattac
cagtacaaccccgttaaaaccgttaaaactaacgttatggggacaatgaatatgttggga
ctagctaaacgcgttaaggcgaggttctttttagcctcaaccagcgaagtttatggtgat
cctgaagttcatccccaaccagaagagtatcggggtagtgttaatcctatcggcatccgt
tcatgttatgacgaaggcaaacgcattgcggaaactttggcttttgattactacagacaa
aataaagtcgaaattcgggtggcgcggattttcaatacctacggaccgagaatgttagaa
aacgatggtcgggtagtgagtaatttcatcgttcaagcgttacagggtaatcctttaact
gtttatggtgatggttcgcaaactcgcagtttctgttacgtttctgacttggtagaaggg
tttatacgcctaatgaatggcgactatgttggcccagtgaatttgggaaatcctggggaa
tacacaattttggaattggcgcaagctgtacaaaacatggtgaacccggacgcaaaaatt
aagtacgagtcattaccatctgatgatccgcgtcgtcgtcagcctgatattactaaagct
aaaaccttgttaaattgggaacctaccattgggctacaagaagggttaaaactgacagta
gaagatttccgtaagcggatgacaagcgatacctag

DBGET integrated database retrieval system