KEGG   Nodularia spumigena: BMF81_03614Help
Entry
BMF81_03614       CDS       T05403                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
nsp  Nodularia spumigena
Pathway
nsp00561  Glycerolipid metabolism
nsp00640  Propanoate metabolism
nsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BMF81_03614 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BMF81_03614 (gldA)
Enzymes [BR:nsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     BMF81_03614 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase AIRC PFK PrpR_N NAD_kinase ANF_receptor
Motif
Other DBs
NCBI-ProteinID: AVZ31176
UniProt: A0A2S0Q421
Position
complement(4089392..4090576)
Genome map
AA seq 394 aa AA seqDB search
MPNQLSTQTVSTQTPSSFLTLTVAPGKIIRGSGVLQTASAEITRLGTRPLIIAGNSTQEI
AQNNLQAILTKGNTAQSSYGVDCCEASLKALKKTAQEHQADVIIGIGGGKALDTAKLVAD
QLHLPVVTIPTSAATCAAWTALSNVYSESGAFLYDVALSRCPDLLILDYDLIQTAPQRTL
VAGIGDAIAKWYEASVSSGNSQQTLIISAVQQARVLRDILLQKSATALKEPGSEVWQEVV
DATVLLAGVIGGMGGAQCRTVAAHAVHNGLTHISGHSSIHGEKVAYGILVQLRLEEMLQS
NQLAASARQQLLKFYAEIGLPKNLSDLGLGNITLQELQTAAEIALEPKSDIHRLPFKVAL
EQLMAAMVSTTAPTDSRDVINRVSTRGMSEEVSE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcccaatcaactttctactcaaactgtgtctactcaaacccctagctcattcttgacg
ctgacggttgctccaggaaaaatcattcgtggttctggagtgttgcagacagcatcagca
gaaattacccgcttagggactcgtccattaattattgccgggaattcgacccaagagatc
gctcaaaacaatttacaagcaattttaaccaaaggaaacaccgctcagtcctcctatggt
gtagattgctgtgaagctagtttaaaagctttaaagaaaacagcccaggaacatcaagcc
gatgtaattattggtatcggtggcggtaaagccttggatacagctaaattagtcgctgat
caattgcatttaccagtggtgacaattcccacctcagcagctacctgtgcggcttggact
gccctttctaacgtatattctgagtcgggggcttttctctacgatgtggcgctgtctcgc
tgtcctgacttattaatccttgactatgatttaattcaaacagcaccacaacggacatta
gttgccggaattggggatgcgatcgcaaaatggtatgaagcatcagtgagtagtggtaat
tctcaacaaaccttaattatctccgcagtgcaacaggcgcgagttctacgagatatatta
ttgcaaaagtcagctacagccctgaaagaaccaggaagtgaggtttggcaagaagtcgta
gatgctaccgtgttactggctggggtaattggcggcatgggtggggcgcagtgtcgcaca
gttgccgcccatgcggtacataatggtttaactcacatttccggacacagcagcatacat
ggtgaaaaagttgcatacggtattttggtgcaactgcgcttagaagaaatgttacaaagc
aatcaactagcggcatcggcacggcaacaattattaaagttctatgcagagattggacta
ccaaagaatttaagtgatttaggtttaggtaacattacattacaagagttacaaacagcc
gccgaaattgctttagaacctaaatcagatatccatcgactaccgtttaaagttgcacta
gaacagttaatggcagcgatggtttctacaactgcaccaacggatagtagagatgtgata
aatcgtgtttccactaggggaatgagtgaagaggtttcagaatga

DBGET integrated database retrieval system