KEGG   Nodularia spumigena: BMF81_04173Help
Entry
BMF81_04173       CDS       T05403                                 

Gene name
hemL_2
Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
nsp  Nodularia spumigena
Pathway
nsp00860  Porphyrin and chlorophyll metabolism
nsp01100  Metabolic pathways
nsp01110  Biosynthesis of secondary metabolites
nsp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nsp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMF81_04173 (hemL_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nsp01007]
    BMF81_04173 (hemL_2)
Enzymes [BR:nsp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BMF81_04173 (hemL_2)
Amino acid related enzymes [BR:nsp01007]
 Aminotransferase (transaminase)
  Class III
   BMF81_04173 (hemL_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AVZ31443
UniProt: A0A2S0QAJ7
Position
complement(4710035..4711333)
Genome map
AA seq 432 aa AA seqDB search
MVNTTIKTTKSQEIFAAAQNLMPGGVSSPVRAFKSVGGQPIVFDRVKDAYIWDVDGNQYI
DYVGTWGPAICGHAHPEVIAALHEALEKGTSFGAPSLLENVLAEMVIDAVPSIEMVRFVN
SGTEACMAVLRLMRAFTNREKIIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPKAAT
QSTLTAPYNDLEAVKALFEENRDEIAGVILEPVVGNAGFITPDAGFLEGLREITHEHGAL
LVFDEVMTGFRIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRRDIMSMIAPAGPVY
QAGTLSGNPLAMTAGIKTLELLQRPGSYEYLDQITQKLADGLLQIATETGHPACGGQISA
MFGLFFTSGPVHNYEDAKKSDMAKFGRFHRGMLERSVYLAPSQFEAGFTSLAHTEADIEQ
TLAVAREVLSSL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttggtaaataccacgattaaaaccacaaaatcacaagaaatctttgccgccgcccaaaac
ctgatgccaggaggagttagttctccagttcgtgccttcaaatcagtgggcggacaaccc
atagtttttgatcgcgtcaaagacgcatacatttgggatgtagatggcaaccaatatatt
gattatgtcggcacttgggggccagctatttgtggtcatgcccatcccgaagtaattgca
gcgctccatgaagccttggaaaaaggtactagcttcggcgctccttcattactggaaaat
gttctggcagaaatggtcattgatgctgttcctagcatcgaaatggtgagatttgtgaat
tcaggcacagaagcttgtatggccgtactgcggttaatgcgggctttcaccaaccgagag
aaaatcatcaagtttgaaggctgctaccacggtcacgccgatatgttcttggtgaaggct
ggttctggtgtggctacccttggtttacccgattcgccaggagtacctaaagccgcaact
caaagcactctgacggctccttacaatgacttggaagctgtcaaagccttatttgaagaa
aaccgtgacgaaattgctggtgtgattctggagccagtagtgggcaatgctgggtttatt
actcctgatgctgggtttctcgaaggtttaagagaaattacccatgaacatggagctttg
ctagtctttgacgaagtgatgaccggttttcgtattgcttacggtggcgctcaggaaaaa
tttggtgtaacaccagacctaacaaccttgggtaaggttattggtggaggcttaccagta
ggagcctacggtggtcgtcgtgatattatgtcaatgattgctcccgcaggccctgtgtat
caagcgggaactctttcaggtaatcccttagcaatgactgctgggattaaaaccttggaa
ttgttgcaaagacctggtagttatgagtatcttgaccaaattactcagaagttagcagat
ggcttactgcaaattgccacagaaactggtcatcctgcttgtggtggtcagattagcgcg
atgtttggcttattcttcacctctgggccagtacataactacgaagatgccaaaaagtca
gatatggctaaatttggtcgcttccatcgcggtatgttagagcggagtgtttatttagca
ccttctcagtttgaggcaggttttacctctttagctcacacagaagccgatattgagcaa
actttagccgttgcgcgagaagtgttatctagtctatag

DBGET integrated database retrieval system