KEGG   Nocardia seriolae: NS506_00571Help
Entry
NS506_00571       CDS       T04599                                 

Gene name
lhgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase LhgO
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
nsr  Nocardia seriolae
Pathway
nsr00310  Lysine degradation
nsr01100  Metabolic pathways
nsr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nsr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    NS506_00571 (lhgO)
Enzymes [BR:nsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     NS506_00571 (lhgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Pyr_redox_2 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: APA94653
UniProt: A0A0B8NHK7
Position
570118..571311
Genome map
AA seq 397 aa AA seqDB search
MYDYCVIGGGIVGVATAHRILERHPAASLLLVEKAEALGRHQTGHNSGVIHSGIYYEPGS
LKARLCVRGAELTKKFAAAHDIPFRECGKLLVATDAAEQARMLALYERSVTNGVEVERLD
AAELVRREPRITGVGALFVASTGIIDYGSVTRALAADVRTAGGEIALNTEITALTETDSA
VTISGPAGSWQARRLVVCAGLQADRMARLAGLDLELRIVPFRGEYYRLPPERANLVRTLI
YPIPDPELPFLGVHLSPTIDGELTVGPNAVLGLAREGYRKGSVNLRDAREILGFRGFHRV
AAANVRTGWRELRNSLFKRGYLAECRRYCPELTVADLLPREAGIRAQAVLRDGTLAHDFL
LERTPRSVHVLNAPSPAATSALPIAEYIADRLDDFVQ
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgactactgcgtgatcggcggcggcatcgtcggggtggccaccgcgcaccgcatt
ctcgaacgccatccggcggcgagcctgctgctggtcgagaaggccgaggccctgggccgg
catcagaccgggcacaacagcggggtcatccactcgggcatctactacgagcccggcagc
ctgaaggcgcggctgtgcgtgcgcggcgcggagctgaccaagaaattcgccgcggcacac
gacattccattccgggaatgcggaaaactgctggtggccaccgatgccgccgagcaggcg
cggatgctggcgctgtacgagcggtcggtcaccaacggggtcgaggtggaacggctggac
gccgccgagctggtgcggcgggagccgcggatcaccggggtcggggcgctgttcgtggcg
agcaccggcatcatcgactacggctcggtcacccgggcgctggccgcggatgtccgcacg
gccgggggcgagatcgcgctgaacacggagatcaccgccctgaccgaaacagactcagcg
gtaacgatttccggcccggccgggagctggcaggcccggcggctggtggtgtgcgcgggc
ctgcaggccgaccggatggcccggctggcgggcctggacctcgagctgcgcatcgtgccg
ttccgcggcgagtactaccgcttgccgccggagcgcgcgaatctggtgcggaccctgatc
tacccgatccccgatcccgaattgccgttcctgggcgtgcatctgagccccaccatcgac
ggcgagctgaccgtcgggcccaatgccgtgctgggcctggcccgggagggctatcgcaag
ggcagcgtgaacctgcgcgacgcccgggagatcctgggcttccgcggttttcatcgggtg
gccgccgccaatgtccgcaccggctggcgggagctgcgcaactcgctgttcaagcgcggc
tatctggccgagtgccgccgctactgcccggaactgacggtcgccgacctgttgccgcgc
gaggccggcatccgggcccaggccgtgctgcgcgacggcacgctggcccacgatttcctg
ctcgagcgcacgccgcgctccgtacacgtgctcaatgccccgtccccggcggccacctcg
gccctgcccatcgccgagtacatagcggaccgattggacgacttcgttcaataa

DBGET integrated database retrieval system