KEGG   Nocardia seriolae: NS506_01936Help
Entry
NS506_01936       CDS       T04599                                 

Definition
(GenBank) 23S rRNA (guanine(745)-N(1))-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
nsr  Nocardia seriolae
Brite
KEGG Orthology (KO) [BR:nsr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:nsr03009]
    NS506_01936
Enzymes [BR:nsr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     NS506_01936
Ribosome biogenesis [BR:nsr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    NS506_01936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_31 Methyltransf_23 PCMT
Motif
Other DBs
NCBI-ProteinID: APA96003
UniProt: A0A1I9Z2A8
Position
complement(2048940..2050118)
Genome map
AA seq 392 aa AA seqDB search
MPVSRRTEPVDRLTGASVDTETPPLGPAEPPPVDRLLACADLLACPQCGHLLAAPVADPA
VGAPSARTLRCPHGHSFDLAKQGYVSLLTGASSKMTGDTPAMLDARAAFQSAGHFAPIAA
ALAAAVATHLPPADIATPIFGAESLPAATSTGSASRDDPAPAISAARRQGFRPGITTPGG
SVAAASAARLATTLLGPGPGPVAGAAVLEIGAGTGYYLAAVLDAVDGARGIALDVSKAAA
RRAARAHGRAGAVLADAWRGLPIRDGGLDAVICVFAPRNADEVARVLREDGRFVVVTPTS
RHLGELIGPLGMVSVDAAKQDRLADSLGERFELVGRESVEYTMALSHRDVANVVAMGPSA
FHAAEQRAEGIAALPDPMAVTAAVSVATYRVR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgccggtgagccgccgcaccgaaccggtggaccggctcaccggcgcctcggtcgatacc
gaaacccctcccctcggcccggccgagccgcccccagtggaccgtctcctcgcctgcgcc
gatcttttggcctgcccacagtgcggccacctcctcgcggctccggtcgccgaccccgcc
gtcggcgccccttccgcccgcaccctgcgctgcccccacggccacagcttcgacctggca
aaacagggctacgtaagcctcctcaccggcgcctccagcaaaatgaccggcgacaccccg
gccatgctcgacgcccgcgccgccttccaatccgccggccacttcgccccgatcgccgcc
gcccttgccgccgccgtcgcgacacatctccctccggctgacatcgccacaccaatattc
ggagcggagtccctcccggctgccacctcgaccggctccgcgagtcgggatgaccccgcc
ccggccatatccgccgcccgccgccaagggttccgccccggaatcacaacgcccggcggc
tctgtagcggccgcctccgcagcccgactggccacaaccctgctcgggccggggccgggg
ccggtggccggtgcggcggtgctcgagatcggagcggggacggggtactacctggcggcc
gtgctggatgcggtagatggggcccggggcatcgcgctggatgtgtcgaaggcggcggcg
cggcgggccgcgcgggcgcatgggcgggccggggcggtgctggccgacgcttggcggggg
ctgccgattcgggatggggggctggacgcggtgatctgcgtgttcgcgccgcgcaatgcc
gatgaggtggctcgggtgctgcgggaggacgggcggttcgttgtggtgacgcctacctcg
cggcatctgggtgagctgatcgggccgctcgggatggtgagtgtggatgcggccaagcag
gatcggctggcggactcgctcggggagcggttcgagctggtcgggcgggaatcggtcgag
tacacgatggcgctctcgcaccgggatgtggcgaatgtggtcgccatggggccgtcggcg
tttcacgcggcggagcagcgggccgaagggattgcggcgctgcccgatccgatggcggtg
accgccgcggtgagtgtggcgacctatcgggtgcgctga

DBGET integrated database retrieval system