KEGG   Nocardia seriolae: NS506_04048Help
Entry
NS506_04048       CDS       T04599                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nsr  Nocardia seriolae
Pathway
nsr00071  Fatty acid degradation
nsr00072  Synthesis and degradation of ketone bodies
nsr00280  Valine, leucine and isoleucine degradation
nsr00310  Lysine degradation
nsr00362  Benzoate degradation
nsr00380  Tryptophan metabolism
nsr00620  Pyruvate metabolism
nsr00630  Glyoxylate and dicarboxylate metabolism
nsr00640  Propanoate metabolism
nsr00650  Butanoate metabolism
nsr00900  Terpenoid backbone biosynthesis
nsr01100  Metabolic pathways
nsr01110  Biosynthesis of secondary metabolites
nsr01120  Microbial metabolism in diverse environments
nsr01130  Biosynthesis of antibiotics
nsr01200  Carbon metabolism
nsr01212  Fatty acid metabolism
nsr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nsr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NS506_04048
   00630 Glyoxylate and dicarboxylate metabolism
    NS506_04048
   00640 Propanoate metabolism
    NS506_04048
   00650 Butanoate metabolism
    NS506_04048
  Lipid metabolism
   00071 Fatty acid degradation
    NS506_04048
   00072 Synthesis and degradation of ketone bodies
    NS506_04048
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NS506_04048
   00310 Lysine degradation
    NS506_04048
   00380 Tryptophan metabolism
    NS506_04048
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NS506_04048
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NS506_04048
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NS506_04048
Enzymes [BR:nsr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NS506_04048
Exosome [BR:nsr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NS506_04048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III PTA_PTB
Motif
Other DBs
NCBI-ProteinID: APA98096
UniProt: A0A1I9Z883
Position
4298084..4299280
Genome map
AA seq 398 aa AA seqDB search
MRRAAIVSPLRTPVGAFGGALRPVPAAELAATVLKAVVARTGIDPARIDDVAMAQSYANS
EAPCIGRWAALEAGLPVELPGFQLDRRCGGGLQAVITAAMMVQTGAADVVIAGGVESMSN
IEYYTRDMRWGARAGNTVFYDRLDRGRERSQPEWRFGRITGMIETAENLAADYGITREAA
DEYAARSHRRAAVAWESGRFADEVIPVEVPRRRGEPLLFTRDEGIRPDSTPEALSKLRVI
QPGGTVTAGNSSQQNDAAAACLVVAEDKLVELGLTPLGFLHDWAAAGCEPSRMGIGPVPA
VAKLFARTGLTFDEMSLIELNEAFATQVLAVLKAWGFDDHTRLNVNGSGISLGHPIAATG
VRILTTVLHELHRRTGRYALETMCIGGGQGLAAIFEAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagacgcgccgcgatagtcagtccgctgcgcacaccggtcggggccttcggcggcgcg
ctgcgcccggttccggccgcggagctggccgccaccgtgctgaaagccgttgtcgcacgc
accggcatcgatccagcccggatcgacgacgtcgccatggcacagtcctatgccaactcc
gaagctccctgcatcgggcgctgggccgccttggaggccggactgccggtggaactgccc
ggcttccagctcgatcggcgctgcggcggcggactccaggccgtgatcaccgccgccatg
atggtgcagaccggcgcggccgacgtggtcatcgcgggcggcgtggaatcgatgagcaat
atcgagtactacacccgcgacatgcgctggggcgcccgcgcgggcaataccgtcttctac
gaccgcctcgaccggggacgtgaacgctcccaaccggaatggcggttcggccggatcacc
ggcatgatcgaaaccgccgagaacctggccgccgactatggcatcacccgcgaggccgcc
gacgaatacgcggcccgcagccaccggcgagccgctgtcgcatgggaatccggccgtttc
gccgacgaagtgatccccgtcgaggtgcctcggcgacgcggcgaaccgctgctgttcacc
cgcgacgagggcatccgccccgactccacccccgaagccctgtcgaaactgcgcgtcatc
cagcccggcggcaccgtcaccgcgggcaattccagccagcagaacgacgccgccgcggcc
tgcctggtggtcgccgaggacaaactcgtcgaactcggcctcaccccactgggtttcctg
cacgactgggcggccgccggctgcgaaccctcccgcatgggcatcggcccggtccccgcc
gtcgccaaactcttcgcccgcaccggcctcaccttcgacgagatgagcctgatcgaactg
aacgaagccttcgccacccaggtcctggccgtcctgaaagcctggggcttcgacgaccac
acccgcctcaatgtcaacggctccggcatctccctgggccaccccatcgccgccaccggc
gtccgcatcctcaccaccgtgctccacgaacttcaccgccgcaccggccgctacgccctc
gaaaccatgtgcataggcggcggccagggcctggcagccatcttcgaggccgcatga

DBGET integrated database retrieval system