KEGG   Nocardia seriolae: NS506_04728Help
Entry
NS506_04728       CDS       T04599                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
nsr  Nocardia seriolae
Pathway
nsr00740  Riboflavin metabolism
nsr00790  Folate biosynthesis
nsr01100  Metabolic pathways
nsr01110  Biosynthesis of secondary metabolites
nsr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nsr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NS506_04728
   00790 Folate biosynthesis
    NS506_04728
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NS506_04728
Enzymes [BR:nsr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     NS506_04728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: APA98774
UniProt: A0A1I9ZA20
Position
complement(4974052..4974792)
Genome map
AA seq 246 aa AA seqDB search
MKELQATEHSLSRKGREMPVRVMELRDRPGGVVEQVVGHVLVFGHPGDGCLVRIHSRCLY
GDALQSDDCDCGPELELAMDLIQDENGQGVLIYLEQEGRGEGLVVKAMGLRTGEQTGADT
FDAYRILGHPIDSRSYDHAADALTHLGLRSVRLMTNNPDKLRAVQDAGLRVEAVPLATEP
RSERAALYMGGQAARRQPQLSRTGRHSRVRSPRENHGCGAAAGGSIVSASGVAVVVRDTI
GVIWLR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagagcttcaggcaaccgagcattcgctctcgcgcaagggccgggagatgccggtg
cgggtgatggagctgcgcgacagacccggtggggtggtcgagcaggtcgtcggccacgtc
ctggtcttcggtcatccgggcgacggctgcctggtccgtatccactcgcgctgcctctac
ggcgatgcgctgcagtccgatgattgtgactgcggaccggagctcgagctggccatggat
ttgattcaggacgagaacggacagggtgttctcatctatctggaacaggagggccggggc
gagggcctggtcgtgaaggcaatggggctgcggaccggcgagcaaaccggggccgatacc
ttcgacgcttaccgcatactgggccatcccatcgattcgcggtcctatgaccatgcggcg
gacgcgctgacgcatctgggtctgcgttcggtgcgcttgatgaccaacaatcccgacaag
ctgcgggcggtgcaggatgccgggctcagggtcgaagcggtgccgctggcgaccgagccc
cgcagcgagcgcgcggcgttgtacatgggaggccaagcggcgaggcgccaaccacagcta
tcccgaaccgggcggcatagccgcgtccggagtccgcgcgagaaccatgggtgcggtgcc
gcggcgggcggatcgatagtttcggccagcggcgtggccgttgtagtccgcgacacaatc
ggcgtgatctggttacgatga

DBGET integrated database retrieval system