KEGG   Nocardia seriolae: NS506_05491Help
Entry
NS506_05491       CDS       T04599                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nsr  Nocardia seriolae
Pathway
nsr00071  Fatty acid degradation
nsr00072  Synthesis and degradation of ketone bodies
nsr00280  Valine, leucine and isoleucine degradation
nsr00310  Lysine degradation
nsr00362  Benzoate degradation
nsr00380  Tryptophan metabolism
nsr00620  Pyruvate metabolism
nsr00630  Glyoxylate and dicarboxylate metabolism
nsr00640  Propanoate metabolism
nsr00650  Butanoate metabolism
nsr00900  Terpenoid backbone biosynthesis
nsr01100  Metabolic pathways
nsr01110  Biosynthesis of secondary metabolites
nsr01120  Microbial metabolism in diverse environments
nsr01130  Biosynthesis of antibiotics
nsr01200  Carbon metabolism
nsr01212  Fatty acid metabolism
nsr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NS506_05491
   00630 Glyoxylate and dicarboxylate metabolism
    NS506_05491
   00640 Propanoate metabolism
    NS506_05491
   00650 Butanoate metabolism
    NS506_05491
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NS506_05491
   00072 Synthesis and degradation of ketone bodies
    NS506_05491
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NS506_05491
   00310 Lysine degradation
    NS506_05491
   00380 Tryptophan metabolism
    NS506_05491
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NS506_05491
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NS506_05491
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NS506_05491
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nsr04147]
    NS506_05491
Enzymes [BR:nsr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NS506_05491
Exosome [BR:nsr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NS506_05491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF2587
Motif
Other DBs
NCBI-ProteinID: APA99537
UniProt: A0A0B8NA40
Position
complement(5762458..5763681)
Genome map
AA seq 407 aa AA seqDB search
MSVHIMGGAQTDFAVNWQRAGASFDALVRTVLEEALDAARVAVTDIGVIHVGNAFGQLFT
GQGHLGGMPATVHPELWGVPASRHEAACASGSMAALAAMADLESGRYDCALVLGAELEKT
VPGAQAAAYMGAAAWAGHETLDTDLVWPTQFAAVADEYDRRYGLDPAHLRAISELNITNA
RLNPNAQTRDWRYGEAAFTADDAANPPVAGMLRCQDCSQMTDGAAAVVLVSDRFLKRHND
IRVDRTAVITGGGHRTVGLPLDEKFRVSAADQYVFPHVRTAVLDALSRARLADIHQLDGV
EVHDCFSMSEYMAIDHLGLTAPGENWKAVESGMIARDGSLPINPGGGLIGIGHPVGATGV
RMLLDAYRQVTDQAGEFQLPNARRYGTVNIGGSTTTVASFVVAAADD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgtgcatattatgggcggcgctcaaaccgatttcgccgtcaactggcagcgcgcc
ggagcctcgttcgatgctctggtccgcaccgtcctggaggaggcgctggacgccgcgcgc
gtggcggtgaccgacatcggcgtgatccacgtgggcaatgcgttcggtcaattgttcacc
ggtcagggccatctcggcggcatgcccgccaccgtccatccggagctgtggggcgtgccc
gcctcccggcacgaggcggcgtgcgcctcgggcagcatggcggccctcgccgccatggcc
gacctcgagtccgggcgctacgactgcgccctggtgctcggggccgaattggagaagacc
gtccccggcgcgcaggcggccgcctacatgggcgcggccgcgtgggcgggccacgagacg
ctcgacaccgacctggtctggcccacccaattcgccgccgtcgccgatgaatacgaccgc
cggtacggcctcgatcccgcgcatctgcgtgccatcagcgagctgaatatcaccaatgcg
cgcctgaatcccaacgcccagacccgggattggcgttacggcgaggccgccttcaccgcc
gacgacgccgccaatccgccggtcgccgggatgctgcgctgccaggactgtagccagatg
accgacggcgcggcggcggtcgtcctggtgtcggatcgattcctgaagcggcacaatgac
atccgtgtcgatcgcaccgccgtgatcaccggcgggggtcaccgcaccgtcggcctgccg
ctcgacgagaagttccgcgtctccgcggccgatcagtacgtcttcccgcacgtccgcacc
gcggtcctcgacgccctgtcgcgggcgcggcttgccgacatccaccagctcgacggtgtc
gaagtgcacgactgcttctccatgtcggagtacatggccatcgaccacctcggcctcacc
gccccgggcgagaactggaaagccgtggaatccggcatgatcgcccgcgacggcagcctg
cccatcaacccgggtggtggtctcatcggcatcggccaccccgtcggggccaccggcgtc
cgcatgctgctcgacgcctaccggcaggtcaccgatcaggcgggcgagttccagctcccg
aatgcgcggcgctacggcaccgtcaatatcggcggcagcacgaccaccgtcgcgagcttc
gtcgtggcggcggccgacgactga

DBGET integrated database retrieval system