KEGG   Nocardia seriolae: NS506_06358Help
Entry
NS506_06358       CDS       T04599                                 

Definition
(GenBank) Malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
nsr  Nocardia seriolae
Pathway
nsr00020  Citrate cycle (TCA cycle)
nsr00620  Pyruvate metabolism
nsr01100  Metabolic pathways
nsr01110  Biosynthesis of secondary metabolites
nsr01120  Microbial metabolism in diverse environments
nsr01130  Biosynthesis of antibiotics
nsr01200  Carbon metabolism
Module
nsr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nsr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NS506_06358
   00620 Pyruvate metabolism
    NS506_06358
Enzymes [BR:nsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     NS506_06358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: APB00394
UniProt: A0A1I9ZET0
Position
complement(6668800..6670323)
Genome map
AA seq 507 aa AA seqDB search
MSNAATIEKTDVVLIGAGIMSATLGALLRQVQPDWSINVFERLDEAAGESSDPWNNAGTG
HSALCELNYTPRNANGEVEITKAIDINERFQVSRQFWSYAVENGVFANPSNFINPIPHVS
FTHGADGVEYLRKRHAALSRHPLFEGMEFIDDAAEFSERLPLMAKGRDFSDPVGLNWTDS
GTDIDFGELTKELLAYLGSSGADIAFGHEVLNLSKQSDGSWLVKVRNLRSRKARVINAKF
VFVGAGGGALPLLQKSGIKEINGFGGFPVSGLFLRATNPNLVTQHEAKVYGQASVGAPPM
SVPHLDTRVINGEKGLLFGPYAGWTPKFLKDGKLTDLIKSVKPNNLFSMLGVGVTEMGLV
NYLVGELLNSQADRVGAMGEFMPRADGRDWELIVAGQRVQVIRRKGVGGVLELGTAVVAA
EDGTIAGLLGASPGASTCVSAMVDVMKKCFPREFSTWEPKLKEMVPSLGVKLSENQALFR
EVWDWSNKALQLDSDNTPKHSGIASHA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaacgctgccacgattgaaaagaccgatgtagtactcatcggcgccggcatcatg
agtgccaccctcggtgccttgctccgacaggtgcagccggactggtcgatcaatgtcttc
gagcgcctggacgaggccgccggggagagcagcgatccctggaacaacgccggtaccggc
cactcggccctgtgcgagctcaactacaccccgcgcaacgccaatggcgaggtggagatc
accaaggccatcgacatcaacgagcggttccaggtctcgcggcagttctggtcctacgcg
gtcgagaacggtgtgttcgccaacccgtcgaacttcatcaaccccatcccgcacgtgagc
ttcacccacggtgcggacggcgtcgaatacctgcgcaagcgccacgcggcgctgtcgcgg
catccgctgttcgagggcatggaattcatcgacgacgcagccgaattcagtgagcggcta
ccgctgatggccaagggtcgcgacttctccgacccggtcggcctgaactggaccgattcc
ggcaccgatatcgacttcggcgagctcaccaaggaactgctggcctacctgggctcctcc
ggcgcggacatcgccttcggccacgaggtgctcaacctgagcaagcagtccgacggctcc
tggctggtcaaggtccgcaacctgcgcagccgcaaggcgcgcgtgatcaacgccaagttc
gtgttcgtgggcgcaggcggcggcgcgctgccgctgctgcagaagtcgggcatcaaggag
atcaacggcttcggcggcttcccggtgtcgggcctgttcctgcgcgccaccaacccgaac
ctggtcacccagcacgaggccaaggtgtacggccaggcgtcggtcggcgcgccgccgatg
tcggtgccgcacttggacactcgcgtcatcaacggtgagaagggcctgctgttcggcccc
tacgccggctggacgccgaagttcctcaaggacggcaagctgaccgacctgatcaagtcg
gtgaagccgaacaacctgttctccatgctgggcgtcggcgtcaccgagatgggcctggtc
aactacctggtcggtgagctgctcaactcgcaggccgatcgggtcggcgcgatgggcgag
ttcatgccgcgcgccgacggccgcgactgggagctgatcgtcgccggtcagcgcgtgcag
gtcatccgccgcaagggcgtgggcggcgtgctggagctgggcaccgcggtcgtcgcggcc
gaggacggcaccatcgccggtctgctcggcgcgtccccgggcgcgtccacctgcgtgagc
gccatggtcgacgtgatgaagaagtgcttcccgcgcgaattctccacgtgggagccgaaa
ctcaaggaaatggtgccgtcgctgggggtcaagctctcggagaaccaggccctgttccgc
gaggtgtgggactggtccaacaaggccctgcaactggattcggacaacacgcccaagcac
tccggtatcgcttctcacgcctag

DBGET integrated database retrieval system