KEGG   Nocardia seriolae: NS506_07361Help
Entry
NS506_07361       CDS       T04599                                 

Gene name
phhA
Definition
(GenBank) Phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
nsr  Nocardia seriolae
Pathway
nsr00360  Phenylalanine metabolism
nsr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nsr00790  Folate biosynthesis
nsr01100  Metabolic pathways
nsr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nsr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    NS506_07361 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NS506_07361 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NS506_07361 (phhA)
Enzymes [BR:nsr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     NS506_07361 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: APB01381
UniProt: A0A0B8NLB2
Position
7694013..7694903
Genome map
AA seq 296 aa AA seqDB search
MFTEAQLYSPVTKGADGDVTVHLSDEHPGVHDPVYRARRNAIAAMALDYRPGEPVPRVEY
SAEEQEVWRIVSAELARKRERYACTEVIAAAERLGLPSDHIPQLDEVSAKLVPLTGFRYA
PAAGLVPLREFFGSFADRTFHSTQYIRHHSAPLYTPEPDAIHEILGHANQLASPRFAALY
ETVGAAVARLETERALKFLADVFWFSLEFGVLRERGEVRCYGAGLLSSYGEIEEFRQADL
RPLDIHAMGTIVYDITHYQPVLYCAESITEIEDVVGGFFDTMTDDTVARLVSVNPV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccgaggctcagctgtactcgccggtcacgaagggggccgacggcgacgtgacg
gtgcacttgagcgacgagcacccgggtgtgcacgatcccgtgtaccgggcccgccgcaac
gccatcgccgccatggccctggattaccggccgggggaaccggtcccgcgcgtcgaatac
tccgcggaggagcaggaggtctggcgcatcgtctcggcggagctggcccgcaagcgggag
cgctacgcctgcacggaggtgatcgctgccgccgaacggctggggctgccgtcggaccac
attccccagctcgacgaggtctccgcgaaactggtgccgctcaccggattccgctacgca
ccggcggccggactggtgccgctgcgcgagttcttcggctccttcgccgaccggaccttc
cactccacccagtacattcgccatcactccgccccgctctacacccccgaacccgatgcc
attcacgaaatcctcggccacgccaatcaattggccagcccccgcttcgcggccctgtac
gagactgtgggcgcggcggtcgcccggctcgagaccgagcgggcgctgaagttcctggcc
gacgtgttctggttctcgctggagttcggcgtgctgcgcgaacgcggcgaagtccgttgc
tacggtgcgggtttgctgtcctcctacggcgagatcgaggagttccgccaggccgacctg
cggccgctggacattcacgccatggggaccatcgtctacgacatcacgcactatcagccg
gtgctgtactgcgccgaatccatcaccgagatcgaggatgtcgtcggcgggttcttcgac
accatgaccgacgacacggtcgcgcggctggtgagcgtgaacccggtctag

DBGET integrated database retrieval system